Recombinant Human TNFSF12 protein, His-tagged
Cat.No. : | TNFSF12-3282H |
Product Overview : | Recombinant Human TNFSF12 protein(1-134 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | August 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-134 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP |
Gene Name | TNFSF12 tumor necrosis factor (ligand) superfamily, member 12 [ Homo sapiens ] |
Official Symbol | TNFSF12 |
Synonyms | TNFSF12; tumor necrosis factor (ligand) superfamily, member 12; tumor necrosis factor ligand superfamily member 12; APO3L; DR3LG; TWEAK; APO3 ligand; APO3/DR3 ligand; TNF-related WEAK inducer of apoptosis; MGC20669; MGC129581; |
Gene ID | 8742 |
mRNA Refseq | NM_003809 |
Protein Refseq | NP_003800 |
MIM | 602695 |
UniProt ID | O43508 |
◆ Recombinant Proteins | ||
TNFSF12-3282H | Recombinant Human TNFSF12 protein, His-tagged | +Inquiry |
ACOT4-888H | Recombinant Human ACOT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ACOT4-907H | Recombinant Human ACOT4 Protein, MYC/DDK-tagged | +Inquiry |
ACOT4-2864H | Recombinant Human ACOT4 protein, His-tagged | +Inquiry |
ACOT4-260H | Recombinant Human ACOT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACOT4 Products
Required fields are marked with *
My Review for All ACOT4 Products
Required fields are marked with *