Cat.No.:	TNFSF13-26H
Product Overview:	Recombinant Human A proliferation-inducing ligand is produced by our Mammalian expression system and the target gene encoding Lys112-Leu250 is expressed with a Flag-His tag at the C-terminus.
Source:	HEK293
Species:	Human
Tag :	His-FLAG
Form:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
AA Sequence:	DYKDDDDKHHHHHHGPGQVQLQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQE TLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Endotoxin:	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity:	Greater than 90% as determined by reducing SDS-PAGE.
Storage:	Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.

Gene Name:	TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Homo sapiens ]
Official Symbol:	TNFSF13
Synonyms:	TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; APRIL; CD256; TALL2; TRDL-1; ligand; UNQ383/PRO715; TALL-2; TNF-related death ligand 1; a proliferation inducing ligand; a proliferation-inducing ligand; tumor necrosis factor-related death ligand-1; TNF- and APOL-related leukocyte expressed ligand 2; tumor necrosis factor ligand superfamily member 13 epsilon; tumor necrosis factor (ligand) superfamily member 13 transcript variant delta
Gene ID:	8741
mRNA Refseq:	NM_003808
Protein Refseq:	NP_003799
MIM:	604472
UniProt ID:	O75888

Online Inquiry