| Cat.No.: | TNFSF13-26H |
| Product Overview: | Recombinant Human A proliferation-inducing ligand is produced by our Mammalian expression system and the target gene encoding Lys112-Leu250 is expressed with a Flag-His tag at the N-terminus. |
| Source: | HEK293 |
| Species: | Human |
| Tag : | His-FLAG |
| Form: | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| AA Sequence: | DYKDDDDKHHHHHHGPGQVQLQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQE TLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
| Endotoxin: | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity: | Greater than 90% as determined by reducing SDS-PAGE. |
| Storage: | Samples are stable for up to twelve months from date of receipt at -70 centigrade. Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
| Gene Name: | TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Homo sapiens ] |
| Official Symbol: | TNFSF13 |
| Synonyms: | TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; APRIL; CD256; TALL2; TRDL-1; ligand; UNQ383/PRO715; TALL-2; TNF-related death ligand 1; a proliferation inducing ligand; a proliferation-inducing ligand; tumor necrosis factor-related death ligand-1; TNF- and APOL-related leukocyte expressed ligand 2; tumor necrosis factor ligand superfamily member 13 epsilon; tumor necrosis factor (ligand) superfamily member 13 transcript variant delta |
| Gene ID: | 8741 |
| mRNA Refseq: | NM_003808 |
| Protein Refseq: | NP_003799 |
| MIM: | 604472 |
| UniProt ID: | O75888 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All TNFSF13 Products
Download Datasheet