Cat.No.: |
TNFSF13-26H |
Product Overview: |
Recombinant Human A proliferation-inducing ligand is produced by our Mammalian expression system and the target gene encoding Lys112-Leu250 is expressed with a Flag-His tag at the N-terminus. |
Source: |
HEK293 |
Species: |
Human |
Tag : |
His-FLAG |
Form: |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
AA Sequence: |
DYKDDDDKHHHHHHGPGQVQLQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQE TLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
Endotoxin: |
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity: |
Greater than 90% as determined by reducing SDS-PAGE. |
Storage: |
Samples are stable for up to twelve months from date of receipt at -70 centigrade. Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution: |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |