"TNFSF13" Related Products

Expand
Expand
Expand

Recombinant Human TNFSF13 Protein, His-FLAG-tagged

Cat.No.: TNFSF13-26H
Product Overview: Recombinant Human A proliferation-inducing ligand is produced by our Mammalian expression system and the target gene encoding Lys112-Leu250 is expressed with a Flag-His tag at the N-terminus.
Source: HEK293
Species: Human
Tag : His-FLAG
Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
AA Sequence: DYKDDDDKHHHHHHGPGQVQLQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKLGGGGSKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQE TLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 90% as determined by reducing SDS-PAGE.
Storage: Samples are stable for up to twelve months from date of receipt at -70 centigrade. Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4 centigrade before opening to recover the entire contents.
Gene Name: TNFSF13 tumor necrosis factor (ligand) superfamily, member 13 [ Homo sapiens ]
Official Symbol: TNFSF13
Synonyms: TNFSF13; tumor necrosis factor (ligand) superfamily, member 13; APRIL; CD256; TALL2; TRDL-1; ligand; UNQ383/PRO715; TALL-2; TNF-related death ligand 1; a proliferation inducing ligand; a proliferation-inducing ligand; tumor necrosis factor-related death ligand-1; TNF- and APOL-related leukocyte expressed ligand 2; tumor necrosis factor ligand superfamily member 13 epsilon; tumor necrosis factor (ligand) superfamily member 13 transcript variant delta
Gene ID: 8741
mRNA Refseq: NM_003808
Protein Refseq: NP_003799
MIM: 604472
UniProt ID: O75888

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.