Recombinant Human TNFSF14 Protein, His-tagged

• Cat.No.: TNFSF14-150H
• Product Overview: Recombinant Human TNFSF14 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Tumor necrosis factor superfamily member 14 (TNFSF14), also known as CD258 and LIGHT, is a cell surface type II transmembrane protein that is expressed as a homotrimer. The extracellular region can be cleaved to generate a soluble cytokine. TNFSF14 is a ligand for the receptors herpesvirus entry mediator (HVEM) and lymphotoxin receptor (LTR). TNFSF14 is expressed on activated NK cells, activated T cells, activated monocytes, immature DCs, and mast cells. TNFSF14 interactions with HVEM induce potent co-stimulatory signaling in T cells and trigger NK cells to produce IFN-γ via NF-κB RelA/p50 pathway signaling. TNFRSF14 produced by tumor-sensing NK cells aids in DC maturation, enabling de novo anti-tumor adaptive immune responses. TNFSF14-HVEM interactions are considered the main drivers of anti-tumor immune responses, whereas TNFSF14-LTR interactions have been characterized as maintaining the infrastructure that supports the anti-tumor response via lymphoid development and cancer cells’ susceptibility to the immune response. TNFSF14 induces the normalization of tumor vasculature, sensitizes tumor cells to IFN-γ-mediated apoptosis, and results in a more inflamed tumor microenvironment (TME). Due to its effects on the TME and anti-tumor immune cell responses, TNFSF14 is being investigated as a target for immunotherapeutic intervention in cancer. TNFSF14 has also been implicated in the development and pathogenesis of inflammatory bowel disease and airway remodeling leading to asthma.
• Molecular Mass: ~20 kDa
• AA Sequence: LQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: TNFSF14 tumor necrosis factor (ligand) superfamily, member 14 [ Homo sapiens (human) ]
• Official Symbol: TNFSF14
• Synonyms: TNFSF14; tumor necrosis factor (ligand) superfamily, member 14; tumor necrosis factor ligand superfamily member 14; CD258; HVEM L; LIGHT; LTg; delta transmembrane LIGHT; herpesvirus entry mediator A; herpesvirus entry mediator ligand; herpesvirus entry mediator-ligand; herpes virus entry mediator ligand; ligand for herpesvirus entry mediator; tumor necrosis factor receptor-like 2; tumor necrosis factor superfamily member LIGHT; TR2; HVEML
• Gene ID: 8740
• mRNA Refseq: NM_003807
• Protein Refseq: NP_003798
• MIM: 604520
• UniProt ID: O43557