Recombinant Human TNNC1 Protein

• Cat.No.: TNNC1-007H
• Product Overview: Recombinant human TNNC1 protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 161
• Description: Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z.
• Form: Solution
• Molecular Mass: 18 kDa
• AA Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
• Purity: > 95%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: 4°C
• Concentration: 1 mg/mL
• Storage Buffer: Sodium-phosphate (pH 7). Sterile-filtered colorless solution.
• Reconstitution: Solution for appropriate storage temperature

Gene Information

• Gene Name: TNNC1 troponin C1, slow skeletal and cardiac type [ Homo sapiens (human) ]
• Official Symbol: TNNC1
• Synonyms: TNNC1; troponin C1, slow skeletal and cardiac type; TNC; TN-C; TNNC; CMD1Z; CMH13; troponin C, slow skeletal and cardiac muscles; cardiac troponin C; slow twitch skeletal/cardiac muscle troponin C; troponin C type 1 (slow)
• Gene ID: 7134
• mRNA Refseq: NM_003280
• Protein Refseq: NP_003271
• MIM: 191040
• UniProt ID: P04463