Recombinant Human TNNC1 Protein

Cat.No. : TNNC1-007H
Product Overview : Recombinant human TNNC1 protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 161
Description : Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. The binding of calcium to TnC abolishes the inhibitory action of TnI, thus allowing the interaction of actin with myosin, the hydrolysis of ATP, and the generation of tension. Mutations in this gene are associated with cardiomyopathy dilated type 1Z.
Form : Solution
Molecular Mass : 18 kDa
AA Sequence : MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Purity : > 95%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : 4°C
Concentration : 1 mg/mL
Storage Buffer : Sodium-phosphate (pH 7). Sterile-filtered colorless solution.
Reconstitution : Solution for appropriate storage temperature
Gene Name TNNC1 troponin C1, slow skeletal and cardiac type [ Homo sapiens (human) ]
Official Symbol TNNC1
Synonyms TNNC1; troponin C1, slow skeletal and cardiac type; TNC; TN-C; TNNC; CMD1Z; CMH13; troponin C, slow skeletal and cardiac muscles; cardiac troponin C; slow twitch skeletal/cardiac muscle troponin C; troponin C type 1 (slow)
Gene ID 7134
mRNA Refseq NM_003280
Protein Refseq NP_003271
MIM 191040
UniProt ID P04463

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNNC1 Products

Required fields are marked with *

My Review for All TNNC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon