Recombinant Human TNNI2 protein, GST-tagged

Cat.No. : TNNI2-30135H
Product Overview : Recombinant Human TNNI2 (1-103 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Leu103
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name TNNI2 troponin I type 2 (skeletal, fast) [ Homo sapiens ]
Official Symbol TNNI2
Synonyms TNNI2; troponin I type 2 (skeletal, fast); troponin I, skeletal, fast; troponin I, fast skeletal muscle; AMCD2B; DA2B; FSSV; troponin I fast twitch 2; troponin I; fast twitch skeletal muscle isoform; troponin I, fast-twitch isoform; fast-twitch skeletal muscle troponin I; troponin I, fast-twitch skeletal muscle isoform; fsTnI;
Gene ID 7136
mRNA Refseq NM_001145829
Protein Refseq NP_001139301
MIM 191043
UniProt ID P48788

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNNI2 Products

Required fields are marked with *

My Review for All TNNI2 Products

Required fields are marked with *

0
cart-icon
0
compare icon