Recombinant Human TNNI2 protein, GST-tagged
Cat.No. : | TNNI2-30135H |
Product Overview : | Recombinant Human TNNI2 (1-103 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu103 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TNNI2 troponin I type 2 (skeletal, fast) [ Homo sapiens ] |
Official Symbol | TNNI2 |
Synonyms | TNNI2; troponin I type 2 (skeletal, fast); troponin I, skeletal, fast; troponin I, fast skeletal muscle; AMCD2B; DA2B; FSSV; troponin I fast twitch 2; troponin I; fast twitch skeletal muscle isoform; troponin I, fast-twitch isoform; fast-twitch skeletal muscle troponin I; troponin I, fast-twitch skeletal muscle isoform; fsTnI; |
Gene ID | 7136 |
mRNA Refseq | NM_001145829 |
Protein Refseq | NP_001139301 |
MIM | 191043 |
UniProt ID | P48788 |
◆ Recombinant Proteins | ||
TNNI2-30870TH | Recombinant Human TNNI2 | +Inquiry |
TNNI2-527HF | Recombinant Full Length Human TNNI2 Protein, GST-tagged | +Inquiry |
Tnni2-7945M | Recombinant Mouse Tnni2 protein, His-tagged | +Inquiry |
Tnni2-6568M | Recombinant Mouse Tnni2 Protein, Myc/DDK-tagged | +Inquiry |
Tnni2-643R | Recombinant Rat Tnni2 protein | +Inquiry |
◆ Native Proteins | ||
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNI2-1802HCL | Recombinant Human TNNI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNNI2 Products
Required fields are marked with *
My Review for All TNNI2 Products
Required fields are marked with *