Recombinant Human TNPO2 Protein, 201-300, N-GST tagged
Cat.No. : | TNPO2-06H |
Product Overview : | Human TNPO2 partial ORF ( NP_038461, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 201-300 |
Description : | Predicted to enable nuclear import signal receptor activity and nuclear localization sequence binding activity. Predicted to be involved in protein import into nucleus. Predicted to act upstream of or within negative regulation of muscle cell differentiation. Predicted to be active in cytoplasm and nucleus. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MDRAQALMDNIDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLTLAEQPICKEVLASHLVQLIP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TNPO2 transportin 2 [ Homo sapiens (human) ] |
Official Symbol | TNPO2 |
Synonyms | TNPO2; transportin 2; transportin-2; FLJ12155; importin 3; IPO3; karyopherin beta 2b; KPNB2B; TRN2; karyopherin beta-2b; karyopherin beta 2b, transportin; transportin 2 (importin 3, karyopherin beta 2b) |
Gene ID | 30000 |
mRNA Refseq | NM_013433 |
Protein Refseq | NP_038461 |
MIM | 603002 |
UniProt ID | B4DRY5 |
◆ Recombinant Proteins | ||
TNPO2-4883R | Recombinant Rhesus monkey TNPO2 Protein, His-tagged | +Inquiry |
TNPO2-3337H | Recombinant Human TNPO2 protein, His-tagged | +Inquiry |
TNPO2-3338H | Recombinant Human TNPO2 protein, His-tagged | +Inquiry |
TNPO2-4697R | Recombinant Rhesus Macaque TNPO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNPO2-1201Z | Recombinant Zebrafish TNPO2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNPO2 Products
Required fields are marked with *
My Review for All TNPO2 Products
Required fields are marked with *