Recombinant Human TOB2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TOB2-4116H
• Product Overview: TOB2 MS Standard C13 and N15-labeled recombinant protein (NP_057356) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TOB2 belongs to the TOB/BTG1 family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.
• Molecular Mass: 36.6 kDa
• AA Sequence: MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLANTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TOB2 transducer of ERBB2, 2 [ Homo sapiens (human) ]
• Official Symbol: TOB2
• Synonyms: TOB2; transducer of ERBB2, 2; TROB2; protein Tob2; bK223H9; TOB4; TOBL; protein Tob4; transducer of erbB-2 2
• Gene ID: 10766
• mRNA Refseq: NM_016272
• Protein Refseq: NP_057356
• MIM: 607396
• UniProt ID: Q14106