Recombinant Human TOB2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TOB2-4116H |
Product Overview : | TOB2 MS Standard C13 and N15-labeled recombinant protein (NP_057356) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TOB2 belongs to the TOB/BTG1 family of antiproliferative proteins, which are involved in the regulation of cell cycle progression. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLANTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TOB2 transducer of ERBB2, 2 [ Homo sapiens (human) ] |
Official Symbol | TOB2 |
Synonyms | TOB2; transducer of ERBB2, 2; TROB2; protein Tob2; bK223H9; TOB4; TOBL; protein Tob4; transducer of erbB-2 2; |
Gene ID | 10766 |
mRNA Refseq | NM_016272 |
Protein Refseq | NP_057356 |
MIM | 607396 |
UniProt ID | Q14106 |
◆ Recombinant Proteins | ||
TOB2-4116H | Recombinant Human TOB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tob2-6575M | Recombinant Mouse Tob2 Protein, Myc/DDK-tagged | +Inquiry |
TOB2-4701R | Recombinant Rhesus Macaque TOB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TOB2-151H | Recombinant Human TOB2 Protein, His-tagged | +Inquiry |
TOB2-4887R | Recombinant Rhesus monkey TOB2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOB2 Products
Required fields are marked with *
My Review for All TOB2 Products
Required fields are marked with *
0
Inquiry Basket