Recombinant Human TOB2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TOB2-4116H
Product Overview : TOB2 MS Standard C13 and N15-labeled recombinant protein (NP_057356) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TOB2 belongs to the TOB/BTG1 family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.
Molecular Mass : 36.6 kDa
AA Sequence : MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLKKKYEGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGAVKVLYLDDSEGCGAPELDKEIKSSFNPDAQVFVPIGSQDSSLSNSPSPSFGQSPSPTFIPRSAQPITFTTASFAATKFGSTKMKKGGGAASGGGVASSGAGGQQPPQQPRMARSPTNSLLKHKSLSLSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPGPFGGSGAGTCNSSSFDMAQVFGGGANSLFLEKTPFVEGLSYNLNTMQYPSQQFQPVVLANTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TOB2 transducer of ERBB2, 2 [ Homo sapiens (human) ]
Official Symbol TOB2
Synonyms TOB2; transducer of ERBB2, 2; TROB2; protein Tob2; bK223H9; TOB4; TOBL; protein Tob4; transducer of erbB-2 2;
Gene ID 10766
mRNA Refseq NM_016272
Protein Refseq NP_057356
MIM 607396
UniProt ID Q14106

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOB2 Products

Required fields are marked with *

My Review for All TOB2 Products

Required fields are marked with *

0
cart-icon