Recombinant Human TOM1L2 protein, His-tagged
| Cat.No. : | TOM1L2-6755H |
| Product Overview : | Recombinant Human TOM1L2 protein(300-457 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 300-457 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | LRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TOM1L2 target of myb1-like 2 (chicken) [ Homo sapiens ] |
| Official Symbol | TOM1L2 |
| Synonyms | TOM1L2; target of myb1-like 2 (chicken); target of myb1 (chicken) homolog like 1; |
| Gene ID | 10731 |
| UniProt ID | Q6ZVM7 |
| ◆ Recombinant Proteins | ||
| TOM1L2-6755H | Recombinant Human TOM1L2 protein, His-tagged | +Inquiry |
| TOM1L2-4656C | Recombinant Chicken TOM1L2 | +Inquiry |
| TOM1L2-4891R | Recombinant Rhesus monkey TOM1L2 Protein, His-tagged | +Inquiry |
| TOM1L2-17216M | Recombinant Mouse TOM1L2 Protein | +Inquiry |
| TOM1L2-4705R | Recombinant Rhesus Macaque TOM1L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TOM1L2-1808HCL | Recombinant Human TOM1L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOM1L2 Products
Required fields are marked with *
My Review for All TOM1L2 Products
Required fields are marked with *
