Recombinant Human TOMM40, His-tagged
| Cat.No. : | TOMM40-31537TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 55-361 of Human TOMM40 with N terminal His tag; Predicted MWt 34 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 55-361 a.a. |
| Description : | TOMM40 is the channel-forming subunit of the translocase of the mitochondrial outer membrane (TOM) complex that is essential for protein import into mitochondria (Humphries et al. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 101 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELF PIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFG VTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGP GLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNP DVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVM SLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGV EFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIV GATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG |
| Sequence Similarities : | Belongs to the Tom40 family. |
| Gene Name | TOMM40 translocase of outer mitochondrial membrane 40 homolog (yeast) [ Homo sapiens ] |
| Official Symbol | TOMM40 |
| Synonyms | TOMM40; translocase of outer mitochondrial membrane 40 homolog (yeast); mitochondrial import receptor subunit TOM40 homolog; C19orf1; D19S1177E; PER EC1; PEREC1; TOM40; |
| Gene ID | 10452 |
| mRNA Refseq | NM_001128916 |
| Protein Refseq | NP_001122388 |
| MIM | 608061 |
| Uniprot ID | O96008 |
| Chromosome Location | 19q13 |
| Pathway | Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
| Function | porin activity; protein transmembrane transporter activity; protein transmembrane transporter activity; voltage-gated anion channel activity; |
| ◆ Recombinant Proteins | ||
| TOMM40-6219R | Recombinant Rat TOMM40 Protein | +Inquiry |
| TOMM40-30H | Recombinant Human TOMM40 protein, His-tagged | +Inquiry |
| TOMM40-31H | Recombinant Human TOMM40 protein, His-tagged | +Inquiry |
| TOMM40-10015Z | Recombinant Zebrafish TOMM40 | +Inquiry |
| TOMM40-4894R | Recombinant Rhesus monkey TOMM40 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOMM40 Products
Required fields are marked with *
My Review for All TOMM40 Products
Required fields are marked with *
