Recombinant Human TOP2A protein(1051-1240 aa), C-His-tagged

• Cat.No.: TOP2A-2638H
• Product Overview: Recombinant Human TOP2A protein(P11388)(1051-1240 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1051-1240 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: QARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIK

Gene Information

• Gene Name: TOP2A topoisomerase (DNA) II alpha 170kDa [ Homo sapiens ]
• Official Symbol: TOP2A
• Synonyms: TOP2A; topoisomerase (DNA) II alpha 170kDa; TOP2, topoisomerase (DNA) II alpha (170kD); DNA topoisomerase 2-alpha; DNA gyrase; DNA topoisomerase II, 170 kD; DNA topoisomerase (ATP-hydrolyzing); DNA topoisomerase II, alpha isozyme; TOP2; TP2A
• Gene ID: 7153
• mRNA Refseq: NM_001067
• Protein Refseq: NP_001058
• MIM: 126430
• UniProt ID: P11388