Recombinant Human TOP2A protein(1051-1240 aa), C-His-tagged
Cat.No. : | TOP2A-2638H |
Product Overview : | Recombinant Human TOP2A protein(P11388)(1051-1240 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1051-1240 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIK |
Gene Name | TOP2A topoisomerase (DNA) II alpha 170kDa [ Homo sapiens ] |
Official Symbol | TOP2A |
Synonyms | TOP2A; topoisomerase (DNA) II alpha 170kDa; TOP2, topoisomerase (DNA) II alpha (170kD); DNA topoisomerase 2-alpha; DNA gyrase; DNA topoisomerase II, 170 kD; DNA topoisomerase (ATP-hydrolyzing); DNA topoisomerase II, alpha isozyme; TOP2; TP2A; |
Gene ID | 7153 |
mRNA Refseq | NM_001067 |
Protein Refseq | NP_001058 |
MIM | 126430 |
UniProt ID | P11388 |
◆ Recombinant Proteins | ||
TOP2A-2611H | Recombinant Human TOP2A, GST-tagged | +Inquiry |
TOP2A-9519M | Recombinant Mouse TOP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
TOP2A-4231H | Recombinant Human TOP2A Protein, His (Fc)-Avi-tagged | +Inquiry |
TOP2A-7701H | Recombinant Human TOP2A protein, His & T7-tagged | +Inquiry |
TOP2A-2638H | Recombinant Human TOP2A protein(1051-1240 aa), C-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOP2A Products
Required fields are marked with *
My Review for All TOP2A Products
Required fields are marked with *