Recombinant Human TOP2A protein(1051-1240 aa), C-His-tagged

Cat.No. : TOP2A-2638H
Product Overview : Recombinant Human TOP2A protein(P11388)(1051-1240 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1051-1240 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKAKGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIK
Gene Name TOP2A topoisomerase (DNA) II alpha 170kDa [ Homo sapiens ]
Official Symbol TOP2A
Synonyms TOP2A; topoisomerase (DNA) II alpha 170kDa; TOP2, topoisomerase (DNA) II alpha (170kD); DNA topoisomerase 2-alpha; DNA gyrase; DNA topoisomerase II, 170 kD; DNA topoisomerase (ATP-hydrolyzing); DNA topoisomerase II, alpha isozyme; TOP2; TP2A;
Gene ID 7153
mRNA Refseq NM_001067
Protein Refseq NP_001058
MIM 126430
UniProt ID P11388

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TOP2A Products

Required fields are marked with *

My Review for All TOP2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon