Recombinant Human TOR1B protein, His-tagged
| Cat.No. : | TOR1B-3227H |
| Product Overview : | Recombinant Human TOR1B protein(25-77 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-77 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | TOR1B |
| Synonyms | TOR1B; torsin family 1, member B (torsin B); torsin-1B; DQ1; MGC4386; torsin family 1 member B; |
| Gene ID | 27348 |
| mRNA Refseq | NM_014506 |
| Protein Refseq | NP_055321 |
| MIM | 608050 |
| UniProt ID | O14657 |
| ◆ Recombinant Proteins | ||
| Tor1b-6587M | Recombinant Mouse Tor1b Protein, Myc/DDK-tagged | +Inquiry |
| TOR1B-3357H | Recombinant Human TOR1B protein, GST-tagged | +Inquiry |
| TOR1B-540H | Recombinant Human TOR1B Protein, His-tagged | +Inquiry |
| TOR1B-4734H | Recombinant Human TOR1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TOR1B-9525M | Recombinant Mouse TOR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TOR1B-864HCL | Recombinant Human TOR1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TOR1B Products
Required fields are marked with *
My Review for All TOR1B Products
Required fields are marked with *



