Recombinant Human TOR1B protein, GST-tagged
Cat.No. : | TOR1B-3357H |
Product Overview : | Recombinant Human TOR1B protein(25-77 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-77 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | TOR1B |
Synonyms | TOR1B; torsin family 1, member B (torsin B); torsin-1B; DQ1; MGC4386; torsin family 1 member B; |
Gene ID | 27348 |
mRNA Refseq | NM_014506 |
Protein Refseq | NP_055321 |
MIM | 608050 |
UniProt ID | O14657 |
◆ Recombinant Proteins | ||
TOR1B-9525M | Recombinant Mouse TOR1B Protein, His (Fc)-Avi-tagged | +Inquiry |
TOR1B-5820H | Recombinant Human TOR1B Protein (Asn98-Thr328), N-His tagged | +Inquiry |
Tor1b-6587M | Recombinant Mouse Tor1b Protein, Myc/DDK-tagged | +Inquiry |
TOR1B-3227H | Recombinant Human TOR1B protein, His-tagged | +Inquiry |
TOR1B-4734H | Recombinant Human TOR1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TOR1B-864HCL | Recombinant Human TOR1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TOR1B Products
Required fields are marked with *
My Review for All TOR1B Products
Required fields are marked with *
0
Inquiry Basket