Recombinant Human TP53 protein(301-390 aa), C-His-tagged
| Cat.No. : | TP53-2547H |
| Product Overview : | Recombinant Human TP53 protein(P04637)(301-390 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 301-390 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 12.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGP |
| Gene Name | TP53 tumor protein p53 [ Homo sapiens ] |
| Official Symbol | TP53 |
| Synonyms | TP53; tumor protein p53; cellular tumor antigen p53; LFS1; Li Fraumeni syndrome; p53; antigen NY-CO-13; mutant p53 protein; phosphoprotein p53; p53 tumor suppressor; truncated p53 protein; tumor suppressor TP53; transformation-related protein 53; P53; TRP53; FLJ92943; |
| Gene ID | 7157 |
| mRNA Refseq | NM_000546 |
| Protein Refseq | NP_000537 |
| MIM | 191170 |
| UniProt ID | P04637 |
| ◆ Recombinant Proteins | ||
| TP53-30547TH | Recombinant Human TP53, GST-tagged | +Inquiry |
| Tp53-5633R | Recombinant Rat Tp53 protein, His-tagged | +Inquiry |
| TP53-6491H | Recombinant Human TP53 Protein (Met1-Asp393), C-His tagged | +Inquiry |
| TP53-611H | Active Recombinant Human TP53, His-tagged | +Inquiry |
| TP53-4893H | Recombinant Human TP53 (Y220C) Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TP53-860HCL | Recombinant Human TP53 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TP53 Products
Required fields are marked with *
My Review for All TP53 Products
Required fields are marked with *



