Recombinant Human TP53I3 protein, GST-tagged
Cat.No. : | TP53I3-1218H |
Product Overview : | Recombinant Human TP53I3 protein(1-332 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-332 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TP53I3 tumor protein p53 inducible protein 3 [ Homo sapiens ] |
Official Symbol | TP53I3 |
Synonyms | TP53I3; tumor protein p53 inducible protein 3; quinone oxidoreductase PIG3; PIG3; p53-induced gene 3 protein; quinone oxidoreductase homolog; |
Gene ID | 9540 |
mRNA Refseq | NM_001206802 |
Protein Refseq | NP_001193731 |
MIM | 605171 |
UniProt ID | Q53FA7 |
◆ Recombinant Proteins | ||
TP53I3-30289TH | Recombinant Human TP53I3, His-tagged | +Inquiry |
TP53I3-3363H | Recombinant Human TP53I3, His-tagged | +Inquiry |
TP53I3-4911R | Recombinant Rhesus monkey TP53I3 Protein, His-tagged | +Inquiry |
TP53I3-5331H | Recombinant Human TP53I3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TP53I3-4725R | Recombinant Rhesus Macaque TP53I3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TP53I3-857HCL | Recombinant Human TP53I3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TP53I3 Products
Required fields are marked with *
My Review for All TP53I3 Products
Required fields are marked with *
0
Inquiry Basket