Recombinant Human TPD52L2 protein, His-tagged
Cat.No. : | TPD52L2-6744H |
Product Overview : | Recombinant Human TPD52L2 protein(1-201 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-201 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TPD52L2 tumor protein D52-like 2 [ Homo sapiens ] |
Official Symbol | TPD52L2 |
Synonyms | TPD52L2; tumor protein D52-like 2; tumor protein D54; D54; hD54; HCCR-binding protein 2; DKFZp686A1765; |
Gene ID | 7165 |
mRNA Refseq | NM_001243891 |
Protein Refseq | NP_001230820 |
MIM | 603747 |
UniProt ID | O43399 |
◆ Recombinant Proteins | ||
TPD52L2-2437H | Recombinant Human TPD52L2 Protein, MYC/DDK-tagged | +Inquiry |
TPD52L2-6237R | Recombinant Rat TPD52L2 Protein | +Inquiry |
Tpd52l2-6593M | Recombinant Mouse Tpd52l2 Protein, Myc/DDK-tagged | +Inquiry |
TPD52L2-6744H | Recombinant Human TPD52L2 protein, His-tagged | +Inquiry |
TPD52L2-2552C | Recombinant Chicken TPD52L2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPD52L2-1814HCL | Recombinant Human TPD52L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPD52L2 Products
Required fields are marked with *
My Review for All TPD52L2 Products
Required fields are marked with *
0
Inquiry Basket