Recombinant Human TPH1 protein, GST-tagged
Cat.No. : | TPH1-30166H |
Product Overview : | Recombinant Human TPH1 (64-123 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Tyr64-Leu123 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | VDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TPH1 tryptophan hydroxylase 1 [ Homo sapiens ] |
Official Symbol | TPH1 |
Synonyms | TPH1; tryptophan hydroxylase 1; TPH, TPRH, tryptophan hydroxylase (tryptophan 5 monooxygenase); tryptophan 5-hydroxylase 1; tryptophan 5 monooxygenase; L-tryptophan hydroxylase; tryptophan 5-monooxygenase 1; indoleacetic acid-5-hydroxylase; tryptophan hydroxylase (tryptophan 5-monooxygenase); TPRH; TRPH; MGC119994; |
Gene ID | 7166 |
mRNA Refseq | NM_004179 |
Protein Refseq | NP_004170 |
MIM | 191060 |
UniProt ID | P17752 |
◆ Recombinant Proteins | ||
Tph1-6594M | Recombinant Mouse Tph1 Protein, Myc/DDK-tagged | +Inquiry |
TPH1-5073C | Recombinant Chicken TPH1 protein, Avi-tagged, Biotinylated | +Inquiry |
TPH1-1723M | Recombinant Mouse TPH1 protein, His-SUMO-tagged | +Inquiry |
TPH1-5071C | Recombinant Chicken TPH1 protein | +Inquiry |
TPH1-17252M | Recombinant Mouse TPH1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPH1-847HCL | Recombinant Human TPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPH1 Products
Required fields are marked with *
My Review for All TPH1 Products
Required fields are marked with *