Recombinant Human TPH1 protein, GST-tagged

• Cat.No.: TPH1-30166H
• Product Overview: Recombinant Human TPH1 (64-123 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Tyr64-Leu123
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: VDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: TPH1 tryptophan hydroxylase 1 [ Homo sapiens ]
• Official Symbol: TPH1
• Synonyms: TPH1; tryptophan hydroxylase 1; TPH, TPRH, tryptophan hydroxylase (tryptophan 5 monooxygenase); tryptophan 5-hydroxylase 1; tryptophan 5 monooxygenase; L-tryptophan hydroxylase; tryptophan 5-monooxygenase 1; indoleacetic acid-5-hydroxylase; tryptophan hydroxylase (tryptophan 5-monooxygenase); TPRH; TRPH; MGC119994
• Gene ID: 7166
• mRNA Refseq: NM_004179
• Protein Refseq: NP_004170
• MIM: 191060
• UniProt ID: P17752