Recombinant Human TPH1 protein, GST-tagged
| Cat.No. : | TPH1-30166H |
| Product Overview : | Recombinant Human TPH1 (64-123 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Tyr64-Leu123 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | VDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | TPH1 tryptophan hydroxylase 1 [ Homo sapiens ] |
| Official Symbol | TPH1 |
| Synonyms | TPH1; tryptophan hydroxylase 1; TPH, TPRH, tryptophan hydroxylase (tryptophan 5 monooxygenase); tryptophan 5-hydroxylase 1; tryptophan 5 monooxygenase; L-tryptophan hydroxylase; tryptophan 5-monooxygenase 1; indoleacetic acid-5-hydroxylase; tryptophan hydroxylase (tryptophan 5-monooxygenase); TPRH; TRPH; MGC119994; |
| Gene ID | 7166 |
| mRNA Refseq | NM_004179 |
| Protein Refseq | NP_004170 |
| MIM | 191060 |
| UniProt ID | P17752 |
| ◆ Recombinant Proteins | ||
| TPH1-6515C | Recombinant Chicken TPH1 | +Inquiry |
| TPH1-5896R | Recombinant Rat TPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TPH1-6239R | Recombinant Rat TPH1 Protein | +Inquiry |
| TPH1-3128H | Recombinant Human TPH1 protein, GST-tagged | +Inquiry |
| TPH1-5071C | Recombinant Chicken TPH1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPH1-847HCL | Recombinant Human TPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPH1 Products
Required fields are marked with *
My Review for All TPH1 Products
Required fields are marked with *
