Recombinant Human TPH1 protein, GST-tagged

Cat.No. : TPH1-30166H
Product Overview : Recombinant Human TPH1 (64-123 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Tyr64-Leu123
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : VDCDINREQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name TPH1 tryptophan hydroxylase 1 [ Homo sapiens ]
Official Symbol TPH1
Synonyms TPH1; tryptophan hydroxylase 1; TPH, TPRH, tryptophan hydroxylase (tryptophan 5 monooxygenase); tryptophan 5-hydroxylase 1; tryptophan 5 monooxygenase; L-tryptophan hydroxylase; tryptophan 5-monooxygenase 1; indoleacetic acid-5-hydroxylase; tryptophan hydroxylase (tryptophan 5-monooxygenase); TPRH; TRPH; MGC119994;
Gene ID 7166
mRNA Refseq NM_004179
Protein Refseq NP_004170
MIM 191060
UniProt ID P17752

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPH1 Products

Required fields are marked with *

My Review for All TPH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon