Recombinant Human TPI1
Cat.No. : | TPI1-31613TH |
Product Overview : | Recombinant full length Human Triosephosphate isomerase, expressed in Saccharomyces cerevisiae, amino acids 1-249. MW 26.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-249 a.a. |
Description : | This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate (G3P) and dihydroxy-acetone phosphate (DHAP) in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEV VCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGE ISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAH ALAEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADN VKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGW LKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGF LVGGASLKPEFVDIINAKQ |
Full Length : | Full L. |
Gene Name | TPI1 triosephosphate isomerase 1 [ Homo sapiens ] |
Official Symbol | TPI1 |
Synonyms | TPI1; triosephosphate isomerase 1; triosephosphate isomerase; |
Gene ID | 7167 |
mRNA Refseq | NM_000365 |
Protein Refseq | NP_000356 |
Uniprot ID | P60174 |
Chromosome Location | 12p13.31 |
Pathway | Fatty Acid Beta Oxidation, organism-specific biosystem; Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => |
Function | isomerase activity; triose-phosphate isomerase activity; triose-phosphate isomerase activity; triose-phosphate isomerase activity; |
◆ Recombinant Proteins | ||
TPI1-5898R | Recombinant Rat TPI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPI1-2240H | Recombinant Human TPI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPI1-1400HFL | Recombinant Full Length Human TPI1 Protein, C-Flag-tagged | +Inquiry |
TPI1-10H | Active Recombinant Human TPI1 Protein, His-tagged | +Inquiry |
TPI1-31613TH | Recombinant Human TPI1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPI1-846HCL | Recombinant Human TPI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPI1 Products
Required fields are marked with *
My Review for All TPI1 Products
Required fields are marked with *