Recombinant Human TPM4 protein, GST-tagged
Cat.No. : | TPM4-3371H |
Product Overview : | Recombinant Human TPM4 protein(1-248 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 1-248 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | TPM4 tropomyosin 4 [ Homo sapiens ] |
Official Symbol | TPM4 |
Synonyms | TPM4; tropomyosin 4; tropomyosin alpha-4 chain; TM30p1; tropomyosin-4; |
mRNA Refseq | NM_001145160 |
Protein Refseq | NP_001138632 |
MIM | 600317 |
UniProt ID | P67936 |
Gene ID | 7171 |
◆ Recombinant Proteins | ||
TPM4-4820H | Recombinant Human TPM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPM4-6899H | Recombinant Human Tropomyosin 4, His-tagged | +Inquiry |
TPM4-9539M | Recombinant Mouse TPM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPM4-6244R | Recombinant Rat TPM4 Protein | +Inquiry |
TPM4-17259M | Recombinant Mouse TPM4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPM4-1036HCL | Recombinant Human TPM4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPM4 Products
Required fields are marked with *
My Review for All TPM4 Products
Required fields are marked with *