Recombinant Human TPO Protein, Fc-tagged
| Cat.No. : | TPO-10H |
| Product Overview : | Recombinant Human TPO Protein with Fc tag was expressed in HEK293. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Description : | This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but the full-length nature of some variants has not been determined. |
| Form : | Liquid |
| AA Sequence : | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEGLEVLFQGGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* |
| Purity : | > 90% determined by SDS-PAGE (Reduced) |
| Storage : | Store at -20 to -80 centigrade. |
| Storage Buffer : | PBS, pH 6.8 |
| Gene Name | TPO thyroid peroxidase [ Homo sapiens (human) ] |
| Official Symbol | TPO |
| Synonyms | TPO; thyroid peroxidase; MSA; TPX; TDH2A; thyroid peroxidase; thyroid microsomal antigen; thyroperoxidase; EC 1.11.1.8 |
| Gene ID | 7173 |
| mRNA Refseq | NM_000547 |
| Protein Refseq | NP_000538 |
| MIM | 606765 |
| UniProt ID | P07202 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPO Products
Required fields are marked with *
My Review for All TPO Products
Required fields are marked with *



