Recombinant Human TPPP protein, His-tagged
| Cat.No. : | TPPP-3373H |
| Product Overview : | Recombinant Human TPPP protein(1-95 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-95 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TPPP tubulin polymerization promoting protein [ Homo sapiens ] |
| Official Symbol | TPPP |
| Synonyms | TPPP; tubulin polymerization promoting protein; tubulin polymerization-promoting protein; brain specific protein p25 alpha; p25; p25alpha; TPPP/p25; TPPP1; p25-alpha; 25 kDa brain-specific protein; glycogen synthase kinase 3 (GSK3) inhibitor p24; p24; |
| Gene ID | 11076 |
| mRNA Refseq | NM_007030 |
| Protein Refseq | NP_008961 |
| MIM | 608773 |
| UniProt ID | O94811 |
| ◆ Recombinant Proteins | ||
| TPPP-1506HFL | Recombinant Full Length Human TPPP Protein, C-Flag-tagged | +Inquiry |
| TPPP-4734R | Recombinant Rhesus Macaque TPPP Protein, His (Fc)-Avi-tagged | +Inquiry |
| TPPP-3613H | Recombinant Human TPPP protein, GST-tagged | +Inquiry |
| TPPP-2243H | Recombinant Human TPPP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Tppp-477M | Recombinant Mouse Tppp Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPPP-839HCL | Recombinant Human TPPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPPP Products
Required fields are marked with *
My Review for All TPPP Products
Required fields are marked with *
