Recombinant Human TPPP3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TPPP3-5113H
• Product Overview: TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057048) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TPPP3 (Tubulin Polymerization Promoting Protein Family Member 3) is a Protein Coding gene. Diseases associated with TPPP3 include Cerebrospinal Fluid Leak and Creutzfeldt-Jakob Disease. Gene Ontology (GO) annotations related to this gene include tubulin binding. An important paralog of this gene is TPPP.
• Molecular Mass: 18.8 kDa
• AA Sequence: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TPPP3 tubulin polymerization-promoting protein family member 3 [Homo sapiens (human) ]
• Official Symbol: TPPP3
• Synonyms: TPPP3; p20; CGI-38; p25gamma; tubulin polymerization-promoting protein family member 3; TPPP/p20; brain specific protein
• Gene ID: 51673
• mRNA Refseq: NM_015964
• Protein Refseq: NP_057048
• MIM: 616957
• UniProt ID: Q9BW30