Recombinant Human TPSB2 protein, His-Myc-tagged
| Cat.No. : | TPSB2-4610H |
| Product Overview : | Recombinant Human TPSB2 protein(P20231)(31-275aa), fused to C-terminal His tag and Myc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His&Myc |
| Protein Length : | 31-275aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.2 kDa |
| AA Sequence : | IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | TPSB2 tryptase beta 2 (gene/pseudogene) [ Homo sapiens ] |
| Official Symbol | TPSB2 |
| Synonyms | TPSB2; tryptase beta 2 (gene/pseudogene); tryptase beta 2; tryptase beta-2; tryptase beta II; tryptase beta III; tryptase-2; tryptase II; tryptase III; mast cell tryptase beta II; mast cell tryptase beta III; TPS2; tryptaseB; tryptaseC; |
| Gene ID | 64499 |
| mRNA Refseq | NM_024164 |
| Protein Refseq | NP_077078 |
| MIM | 191081 |
| UniProt ID | P20231 |
| ◆ Recombinant Proteins | ||
| TPSB2-18H | Active Recombinant Human TPSB2 Protein (Met1-Pro275), C-10×His-tagged | +Inquiry |
| TPSB2-419M | Recombinant Mouse TPSB2 protein, His-tagged | +Inquiry |
| TPSB2-6250R | Recombinant Rat TPSB2 Protein | +Inquiry |
| Tpsb2-8235R | Recombinant Rat Tpsb2 protein, His-tagged | +Inquiry |
| Tpsb2-8234M | Recombinant Mouse Tpsb2 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPSB2-835HCL | Recombinant Human TPSB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPSB2 Products
Required fields are marked with *
My Review for All TPSB2 Products
Required fields are marked with *
