Recombinant Human TPSB2 protein, His-Myc-tagged

Cat.No. : TPSB2-4610H
Product Overview : Recombinant Human TPSB2 protein(P20231)(31-275aa), fused to C-terminal His tag and Myc tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His&Myc
Protein Length : 31-275aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.2 kDa
AA Sequence : IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name TPSB2 tryptase beta 2 (gene/pseudogene) [ Homo sapiens ]
Official Symbol TPSB2
Synonyms TPSB2; tryptase beta 2 (gene/pseudogene); tryptase beta 2; tryptase beta-2; tryptase beta II; tryptase beta III; tryptase-2; tryptase II; tryptase III; mast cell tryptase beta II; mast cell tryptase beta III; TPS2; tryptaseB; tryptaseC;
Gene ID 64499
mRNA Refseq NM_024164
Protein Refseq NP_077078
MIM 191081
UniProt ID P20231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPSB2 Products

Required fields are marked with *

My Review for All TPSB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon