Recombinant Human TRA2B protein, His-SUMO-tagged
Cat.No. : | TRA2B-3488H |
Product Overview : | Recombinant Human TRA2B protein(P62995)(111-201aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 111-201aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | TRA2B transformer 2 beta homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | TRA2B |
Synonyms | TRA2B; transformer 2 beta homolog (Drosophila); SFRS10, splicing factor, arginine/serine rich 10 (transformer 2 homolog, Drosophila); transformer-2 protein homolog beta; Htra2 beta; TRA-2 beta; transformer-2 protein homolog B; splicing factor, arginine/serine-rich 10 (transformer 2 homolog, Drosophila); SFRS10; SRFS10; TRAN2B; TRA2-BETA; Htra2-beta; DKFZp686F18120; |
Gene ID | 6434 |
mRNA Refseq | NM_001243879 |
Protein Refseq | NP_001230808 |
MIM | 602719 |
UniProt ID | P62995 |
◆ Recombinant Proteins | ||
TRA2B-6244C | Recombinant Chicken TRA2B | +Inquiry |
TRA2B-9553M | Recombinant Mouse TRA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
TRA2B-2247H | Recombinant Human TRA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
TRA2B-1380HFL | Recombinant Full Length Human TRA2B Protein, C-Flag-tagged | +Inquiry |
TRA2B-11414Z | Recombinant Zebrafish TRA2B | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRA2B-827HCL | Recombinant Human TRA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRA2B Products
Required fields are marked with *
My Review for All TRA2B Products
Required fields are marked with *
0
Inquiry Basket