Recombinant Human TRAF3IP2 Protein, GST-Tagged
Cat.No. : | TRAF3IP2-1335H |
Product Overview : | Human TRAF3IP2 partial ORF (AAH02823, 451 a.a. - 565 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene. [provided by RefSeq, Aug 2009] |
Molecular Mass : | 38.39 kDa |
AA Sequence : | LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRAF3IP2 TRAF3 interacting protein 2 [ Homo sapiens ] |
Official Symbol | TRAF3IP2 |
Synonyms | TRAF3IP2; TRAF3 interacting protein 2; C6orf2, C6orf4, C6orf5, C6orf6, chromosome 6 open reading frame 2, chromosome 6 open reading frame 5; adapter protein CIKS; ACT1; CIKS; DKFZP586G0522; NFkB-activating protein ACT1; connection to IKK and SAPK/JNK; nuclear factor NF-kappa-B activator 1; C6orf2; C6orf4; C6orf5; C6orf6; PSORS13; MGC3581; DKFZp586G0522; |
Gene ID | 10758 |
mRNA Refseq | NM_001164281 |
Protein Refseq | NP_001157753 |
MIM | 607043 |
UniProt ID | O43734 |
◆ Recombinant Proteins | ||
TRAF3IP2-2918H | Recombinant Human TRAF3IP2 protein, His-tagged | +Inquiry |
TRAF3IP2-4746R | Recombinant Rhesus Macaque TRAF3IP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAF3IP2-1335H | Recombinant Human TRAF3IP2 Protein, GST-Tagged | +Inquiry |
TRAF3IP2-4932R | Recombinant Rhesus monkey TRAF3IP2 Protein, His-tagged | +Inquiry |
TRAF3IP2-3150H | Recombinant Human TRAF3IP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAF3IP2-821HCL | Recombinant Human TRAF3IP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAF3IP2 Products
Required fields are marked with *
My Review for All TRAF3IP2 Products
Required fields are marked with *
0
Inquiry Basket