Recombinant Human TRAFD1 protein, His-tagged
Cat.No. : | TRAFD1-3786H |
Product Overview : | Recombinant Human TRAFD1 protein(105 - 335 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 105 - 335 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGEEKRNEVAIPPNAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQERNRGQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLSDIKGAADEIMLPCEFCEELYPEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRAFD1 TRAF-type zinc finger domain containing 1 [ Homo sapiens ] |
Official Symbol | TRAFD1 |
Synonyms | TRAFD1; TRAF-type zinc finger domain containing 1; TRAF-type zinc finger domain-containing protein 1; FLN29; FLN29 gene product; |
Gene ID | 10906 |
mRNA Refseq | NM_001143906 |
Protein Refseq | NP_001137378 |
MIM | 613197 |
UniProt ID | O14545 |
◆ Recombinant Proteins | ||
Trafd1-6622M | Recombinant Mouse Trafd1 Protein, Myc/DDK-tagged | +Inquiry |
TRAFD1-9561M | Recombinant Mouse TRAFD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRAFD1-17293M | Recombinant Mouse TRAFD1 Protein | +Inquiry |
TRAFD1-3786H | Recombinant Human TRAFD1 protein, His-tagged | +Inquiry |
TRAFD1-4936R | Recombinant Rhesus monkey TRAFD1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRAFD1-815HCL | Recombinant Human TRAFD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRAFD1 Products
Required fields are marked with *
My Review for All TRAFD1 Products
Required fields are marked with *
0
Inquiry Basket