Recombinant Human TRAP1 protein, GST-tagged

• Cat.No.: TRAP1-3622H
• Product Overview: Recombinant Human TRAP1 protein(446-704 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 446-704 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TRAP1 TNF receptor-associated protein 1 [ Homo sapiens ]
• Official Symbol: TRAP1
• Synonyms: TRAP1; TNF receptor-associated protein 1; heat shock protein 75 kDa, mitochondrial; HSP75; HSP90L; HSP 75; TRAP-1; TNFR-associated protein 1; tumor necrosis factor type 1 receptor associated protein; tumor necrosis factor type 1 receptor-associated protein
• Gene ID: 10131
• mRNA Refseq: NM_016292
• Protein Refseq: NP_057376
• MIM: 606219
• UniProt ID: Q12931