Recombinant Human TRAP1 protein, GST-tagged
| Cat.No. : | TRAP1-3622H | 
| Product Overview : | Recombinant Human TRAP1 protein(446-704 aa), fused to GST tag, was expressed in E. coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 446-704 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. | 
| AA Sequence : | MREGIVTATEQEVKEDIAKLLRYESSALPSGQLTSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRASEPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | TRAP1 TNF receptor-associated protein 1 [ Homo sapiens ] | 
| Official Symbol | TRAP1 | 
| Synonyms | TRAP1; TNF receptor-associated protein 1; heat shock protein 75 kDa, mitochondrial; HSP75; HSP90L; HSP 75; TRAP-1; TNFR-associated protein 1; tumor necrosis factor type 1 receptor associated protein; tumor necrosis factor type 1 receptor-associated protein; | 
| Gene ID | 10131 | 
| mRNA Refseq | NM_016292 | 
| Protein Refseq | NP_057376 | 
| MIM | 606219 | 
| UniProt ID | Q12931 | 
| ◆ Recombinant Proteins | ||
| TRAP1-17301M | Recombinant Mouse TRAP1 Protein | +Inquiry | 
| Trap1-454M | Recombinant Mouse Trap1 protein, His-tagged | +Inquiry | 
| Trap1-5363M | Recombinant Mouse Trap1 protein, His&Myc-tagged | +Inquiry | 
| TRAP1-6260R | Recombinant Rat TRAP1 Protein | +Inquiry | 
| TRAP1-6350Z | Recombinant Zebrafish TRAP1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| TRAP1-811HCL | Recombinant Human TRAP1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAP1 Products
Required fields are marked with *
My Review for All TRAP1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            