Recombinant Human TRAPPC13 Protein, GST-Tagged
Cat.No. : | TRAPPC13-0094H |
Product Overview : | Human TRAPPC13 full-length ORF (BAB14633.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TRAPPC13 (Trafficking Protein Particle Complex 13) is a Protein Coding gene. Among its related pathways are Vesicle-mediated transport and RAB GEFs exchange GTP for GDP on RABs. |
Molecular Mass : | 65.9 kDa |
AA Sequence : | MLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNMTTSPMFMEKVSLEPSIMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVER |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRAPPC13 trafficking protein particle complex 13 [ Homo sapiens (human) ] |
Official Symbol | TRAPPC13 |
Synonyms | TRAPPC13; trafficking protein particle complex 13; C5orf44; Trafficking Protein Particle Complex 13; Trs65-Related; Trafficking Protein Particle Complex Subunit 13; Chromosome 5 Open Reading Frame 44; UPF0533 Protein C5orf44; trafficking protein particle complex subunit 13; Trs65-related; UPF0533 protein C5orf44 |
Gene ID | 80006 |
mRNA Refseq | NM_024941 |
Protein Refseq | NP_079217 |
UniProt ID | A5PLN9 |
◆ Recombinant Proteins | ||
TRAPPC13-9943Z | Recombinant Zebrafish TRAPPC13 | +Inquiry |
TRAPPC13-8058Z | Recombinant Zebrafish TRAPPC13 | +Inquiry |
TRAPPC13-2626H | Recombinant Human TRAPPC13 Protein, MYC/DDK-tagged | +Inquiry |
TRAPPC13-2633H | Recombinant Human TRAPPC13 Protein, His-tagged | +Inquiry |
TRAPPC13-0094H | Recombinant Human TRAPPC13 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAPPC13 Products
Required fields are marked with *
My Review for All TRAPPC13 Products
Required fields are marked with *