Recombinant Human TRDN protein, GST-tagged
Cat.No. : | TRDN-301300H |
Product Overview : | Recombinant Human TRDN (75-293 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Asn75-Tyr293 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | NFSASSIAKIGSDPLKLVRDAMEETTDWIYGFFSLLSDIISSEDEEDDDGDEDSDKGEIDEPPLRKKEIHKDKTEKQEKPERKIQTKVTHKEKEKGKEKVREKEKPEKKATHKEKIEKKEKPETKTVAKEQKKAKTAEKSEEKTKKEVKGGKQEKVKQTAAKVKEVQKTPSKPKEKEDKEKAAVSKHEQKGQSPAIPPPLPTEQASRPTPASPALEGKY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TRDN triadin [ Homo sapiens ] |
Official Symbol | TRDN |
Synonyms | TRDN; triadin; TDN; TRISK; MGC88285; DKFZp779I2253; |
Gene ID | 10345 |
mRNA Refseq | NM_001251987 |
Protein Refseq | NP_001238916 |
MIM | 603283 |
UniProt ID | Q13061 |
◆ Recombinant Proteins | ||
TRDN-6266R | Recombinant Rat TRDN Protein | +Inquiry |
Trdn-8248R | Recombinant Rat Trdn protein, His & T7-tagged | +Inquiry |
TRDN-5923R | Recombinant Rat TRDN Protein, His (Fc)-Avi-tagged | +Inquiry |
TRDN-17317M | Recombinant Mouse TRDN Protein | +Inquiry |
TRDN-2837H | Recombinant Human TRDN protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRDN Products
Required fields are marked with *
My Review for All TRDN Products
Required fields are marked with *