Recombinant Human TRIM49 protein, GST-tagged

Cat.No. : TRIM49-3533H
Product Overview : Recombinant Human TRIM49 protein(275-340 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 275-340 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : ITGLRDRLNQFRVHITLHHEEANSDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TRIM49 tripartite motif containing 49 [ Homo sapiens ]
Official Symbol TRIM49
Synonyms TRIM49; tripartite motif containing 49; ring finger protein 18 , RNF18, tripartite motif containing 49; tripartite motif-containing protein 49; ring finger protein 18; tripartite motif-containing 49; testis-specific RING Finger protein; testis-specific ring-finger protein; RNF18; TRIM49L2;
mRNA Refseq NM_020358
Protein Refseq NP_065091
MIM 606124
UniProt ID P0CI25
Gene ID 57093

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM49 Products

Required fields are marked with *

My Review for All TRIM49 Products

Required fields are marked with *

0
cart-icon