Recombinant Human TRIM49 protein, GST-tagged
| Cat.No. : | TRIM49-3533H |
| Product Overview : | Recombinant Human TRIM49 protein(275-340 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 275-340 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | ITGLRDRLNQFRVHITLHHEEANSDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGK |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | TRIM49 tripartite motif containing 49 [ Homo sapiens ] |
| Official Symbol | TRIM49 |
| Synonyms | TRIM49; tripartite motif containing 49; ring finger protein 18 , RNF18, tripartite motif containing 49; tripartite motif-containing protein 49; ring finger protein 18; tripartite motif-containing 49; testis-specific RING Finger protein; testis-specific ring-finger protein; RNF18; TRIM49L2; |
| mRNA Refseq | NM_020358 |
| Protein Refseq | NP_065091 |
| MIM | 606124 |
| UniProt ID | P0CI25 |
| Gene ID | 57093 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM49 Products
Required fields are marked with *
My Review for All TRIM49 Products
Required fields are marked with *
