Recombinant Human TRIM59 protein, His-tagged
| Cat.No. : | TRIM59-3115H |
| Product Overview : | Recombinant Human TRIM59 protein(128-326 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 128-326 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | TRIM59 tripartite motif containing 59 [ Homo sapiens ] |
| Official Symbol | TRIM59 |
| Synonyms | TRIM59; tripartite motif containing 59; TRIM57, tripartite motif containing 57 , tripartite motif containing 59; tripartite motif-containing protein 59; Mrf1; RNF104; TSBF1; tumor suppressor TSBF1; RING finger protein 104; tumor suppressor TSBF-1; tripartite motif-containing 57; tripartite motif-containing 59; MRF1; TRIM57; MGC26631; MGC129860; MGC129861; |
| mRNA Refseq | NM_173084 |
| Protein Refseq | NP_775107 |
| UniProt ID | Q8IWR1 |
| Gene ID | 286827 |
| ◆ Recombinant Proteins | ||
| RFL4481MF | Recombinant Full Length Mouse Tripartite Motif-Containing Protein 59(Trim59) Protein, His-Tagged | +Inquiry |
| TRIM59-17385M | Recombinant Mouse TRIM59 Protein | +Inquiry |
| TRIM59-3115H | Recombinant Human TRIM59 protein, His-tagged | +Inquiry |
| TRIM59-2974C | Recombinant Chicken TRIM59 | +Inquiry |
| RFL29040GF | Recombinant Full Length Chicken Tripartite Motif-Containing Protein 59(Trim59) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM59 Products
Required fields are marked with *
My Review for All TRIM59 Products
Required fields are marked with *
