Recombinant Human TRIM59 protein, His-tagged

Cat.No. : TRIM59-3115H
Product Overview : Recombinant Human TRIM59 protein(128-326 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability July 22, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 128-326 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : GHPIDDLQSAYLKEKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDVGNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEF
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name TRIM59 tripartite motif containing 59 [ Homo sapiens ]
Official Symbol TRIM59
Synonyms TRIM59; tripartite motif containing 59; TRIM57, tripartite motif containing 57 , tripartite motif containing 59; tripartite motif-containing protein 59; Mrf1; RNF104; TSBF1; tumor suppressor TSBF1; RING finger protein 104; tumor suppressor TSBF-1; tripartite motif-containing 57; tripartite motif-containing 59; MRF1; TRIM57; MGC26631; MGC129860; MGC129861;
mRNA Refseq NM_173084
Protein Refseq NP_775107
UniProt ID Q8IWR1
Gene ID 286827

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM59 Products

Required fields are marked with *

My Review for All TRIM59 Products

Required fields are marked with *

0
cart-icon
0
compare icon