Recombinant Human TRIM62 protein, GST-tagged
Cat.No. : | TRIM62-3418H |
Product Overview : | Recombinant Human TRIM62(1 a.a. - 475 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-475 a.a. |
Description : | TRIM62 played an important role in many functions. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 80.7 kDa |
AA Sequence : | MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEPALAPSLKLANIVERY SSFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQALQDSE REHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKV QEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEKTQWVIGLAHEAASRK GSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFLDYDQGLLIFYNADDMSWLYTFREKFPGKLC SYFSPGQSHANGKNVQPLRINTVRI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TRIM62 tripartite motif containing 62 [ Homo sapiens ] |
Official Symbol | TRIM62 |
Synonyms | TRIM62; tripartite motif containing 62; tripartite motif-containing protein 62; DEAR1; ductal epithelium associated RING Chromosome 1; FLJ10759; tripartite motif-containing 62; ductal epithelium-associated RING Chromosome 1; FLJ16558; |
Gene ID | 55223 |
mRNA Refseq | NM_018207 |
Protein Refseq | NP_060677 |
MIM | |
UniProt ID | Q9BVG3 |
Chromosome Location | 1p35.1 |
Function | metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
TRIM62-3417H | Recombinant Human TRIM62 protein, His-tagged | +Inquiry |
TRIM62-5150Z | Recombinant Zebrafish TRIM62 | +Inquiry |
TRIM62-4972R | Recombinant Rhesus monkey TRIM62 Protein, His-tagged | +Inquiry |
TRIM62-3416H | Recombinant Human TRIM62, His-tagged | +Inquiry |
TRIM62-3418H | Recombinant Human TRIM62 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM62-1832HCL | Recombinant Human TRIM62 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM62 Products
Required fields are marked with *
My Review for All TRIM62 Products
Required fields are marked with *