Recombinant Human TRIM62 protein, GST-tagged
| Cat.No. : | TRIM62-3418H |
| Product Overview : | Recombinant Human TRIM62(1 a.a. - 475 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-475 a.a. |
| Description : | TRIM62 played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 80.7 kDa |
| AA Sequence : | MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEPALAPSLKLANIVERY SSFPLDAILNARRAARPCQAHDKVKLFCLTDRALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQALQDSE REHTEALQLLKRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKV QEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLD PGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEKTQWVIGLAHEAASRK GSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFLDYDQGLLIFYNADDMSWLYTFREKFPGKLC SYFSPGQSHANGKNVQPLRINTVRI |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TRIM62 tripartite motif containing 62 [ Homo sapiens ] |
| Official Symbol | TRIM62 |
| Synonyms | TRIM62; tripartite motif containing 62; tripartite motif-containing protein 62; DEAR1; ductal epithelium associated RING Chromosome 1; FLJ10759; tripartite motif-containing 62; ductal epithelium-associated RING Chromosome 1; FLJ16558; |
| Gene ID | 55223 |
| mRNA Refseq | NM_018207 |
| Protein Refseq | NP_060677 |
| MIM | |
| UniProt ID | Q9BVG3 |
| Chromosome Location | 1p35.1 |
| Function | metal ion binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| TRIM62-4972R | Recombinant Rhesus monkey TRIM62 Protein, His-tagged | +Inquiry |
| TRIM62-3416H | Recombinant Human TRIM62, His-tagged | +Inquiry |
| TRIM62-4786R | Recombinant Rhesus Macaque TRIM62 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TRIM62-3417H | Recombinant Human TRIM62 protein, His-tagged | +Inquiry |
| TRIM62-610HF | Recombinant Full Length Human TRIM62 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIM62-1832HCL | Recombinant Human TRIM62 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM62 Products
Required fields are marked with *
My Review for All TRIM62 Products
Required fields are marked with *
