Recombinant Human TRIM72
Cat.No. : | TRIM72-31611TH |
Product Overview : | Recombinant fragment of Human TRIM72 with proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Molecular Weight : | 36.630kDa inclusive of tags |
Biological activity : | This product is useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced. |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAE |
Sequence Similarities : | Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger. |
Gene Name | TRIM72 tripartite motif containing 72 [ Homo sapiens ] |
Official Symbol | TRIM72 |
Synonyms | TRIM72; tripartite motif containing 72; tripartite motif-containing protein 72; |
Gene ID | 493829 |
mRNA Refseq | NM_001008274 |
Protein Refseq | NP_001008275 |
MIM | 613288 |
Uniprot ID | Q6ZMU5 |
Chromosome Location | 16p11.2 |
Function | metal ion binding; phosphatidylserine binding; zinc ion binding; |
◆ Recombinant Proteins | ||
TRIM72-17398M | Recombinant Mouse TRIM72 Protein | +Inquiry |
TRIM72-5943R | Recombinant Rat TRIM72 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRIM72-2217HFL | Recombinant Full Length Human TRIM72 protein, Flag-tagged | +Inquiry |
TRIM72-4780H | Recombinant Human TRIM72 Protein, GST-tagged | +Inquiry |
TRIM72-12H | Recombinant Human TRIM72 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM72-1835HCL | Recombinant Human TRIM72 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRIM72 Products
Required fields are marked with *
My Review for All TRIM72 Products
Required fields are marked with *
0
Inquiry Basket