Recombinant Human TRIM72

• Cat.No.: TRIM72-31611TH
• Product Overview: Recombinant fragment of Human TRIM72 with proprietary tag, 36.63kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Biological activity: This product is useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced.
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAE
• Sequence Similarities: Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger.

Gene Information

• Gene Name: TRIM72 tripartite motif containing 72 [ Homo sapiens ]
• Official Symbol: TRIM72
• Synonyms: TRIM72; tripartite motif containing 72; tripartite motif-containing protein 72
• Gene ID: 493829
• mRNA Refseq: NM_001008274
• Protein Refseq: NP_001008275
• MIM: 613288
• Uniprot ID: Q6ZMU5
• Chromosome Location: 16p11.2
• Function: metal ion binding; phosphatidylserine binding; zinc ion binding