Recombinant Human TRIM72

Cat.No. : TRIM72-31611TH
Product Overview : Recombinant fragment of Human TRIM72 with proprietary tag, 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Biological activity : This product is useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced.
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAE
Sequence Similarities : Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger.
Gene Name TRIM72 tripartite motif containing 72 [ Homo sapiens ]
Official Symbol TRIM72
Synonyms TRIM72; tripartite motif containing 72; tripartite motif-containing protein 72;
Gene ID 493829
mRNA Refseq NM_001008274
Protein Refseq NP_001008275
MIM 613288
Uniprot ID Q6ZMU5
Chromosome Location 16p11.2
Function metal ion binding; phosphatidylserine binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRIM72 Products

Required fields are marked with *

My Review for All TRIM72 Products

Required fields are marked with *

0
cart-icon
0
compare icon