Recombinant Human TRIM72
| Cat.No. : | TRIM72-31611TH |
| Product Overview : | Recombinant fragment of Human TRIM72 with proprietary tag, 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Biological activity : | This product is useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HClNote: Glutathione is reduced. |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAE |
| Sequence Similarities : | Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger. |
| Gene Name | TRIM72 tripartite motif containing 72 [ Homo sapiens ] |
| Official Symbol | TRIM72 |
| Synonyms | TRIM72; tripartite motif containing 72; tripartite motif-containing protein 72; |
| Gene ID | 493829 |
| mRNA Refseq | NM_001008274 |
| Protein Refseq | NP_001008275 |
| MIM | 613288 |
| Uniprot ID | Q6ZMU5 |
| Chromosome Location | 16p11.2 |
| Function | metal ion binding; phosphatidylserine binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| TRIM72-4780H | Recombinant Human TRIM72 Protein, GST-tagged | +Inquiry |
| Trim72-29HCL | Recombinant Mouse Trim72 overexpression lysate | +Inquiry |
| TRIM72-4614H | Recombinant Human TRIM72 protein, His&Myc-tagged | +Inquiry |
| TRIM72-480H | Recombinant Human TRIM72 protein, GST-tagged | +Inquiry |
| TRIM72-9624M | Recombinant Mouse TRIM72 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIM72-1835HCL | Recombinant Human TRIM72 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM72 Products
Required fields are marked with *
My Review for All TRIM72 Products
Required fields are marked with *
