Recombinant Human TRIP10, His-tagged
| Cat.No. : | TRIP10-27250TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1-330 of Human Cip4 isoforms 2,3 and 4 with a N terminal His tag; predicted MWt 39 kDa: |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-330 a.a. |
| Description : | Cdc42-interacting protein 4 is a protein that in humans is encoded by the TRIP10 gene. |
| Conjugation : | HIS |
| Tissue specificity : | Expressed in brain, colon, heart, kidney, liver, lung, megakaryocyte, ovary, pancreas, peripheral blood lymphocytes, placenta, prostate, skeletal muscle, small intestine, spleen, testis, thymus and trachea. |
| Form : | Lyophilised:Reconstitution with 108 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQ AYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQ EVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMH FQEGRRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAE RLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQL QRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYG LLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSLGTPSDGRPEL RGPGRSRTKRWPFGKKNKTV |
| Sequence Similarities : | Belongs to the FNBP1 family.Contains 1 FCH domain.Contains 1 REM (Hr1) repeat.Contains 1 SH3 domain. |
| Gene Name | TRIP10 thyroid hormone receptor interactor 10 [ Homo sapiens ] |
| Official Symbol | TRIP10 |
| Synonyms | TRIP10; thyroid hormone receptor interactor 10; salt tolerator , STOT; cdc42-interacting protein 4; Cdc42 interacting protein; CIP4; HSTP; STP; |
| Gene ID | 9322 |
| mRNA Refseq | NM_004240 |
| Protein Refseq | NP_004231 |
| MIM | 604504 |
| Uniprot ID | Q15642 |
| Chromosome Location | 19p13.3 |
| Pathway | Insulin Pathway, organism-specific biosystem; Insulin signaling pathway, organism-specific biosystem; Insulin signaling pathway, conserved biosystem; Insulin-mediated glucose transport, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; |
| Function | identical protein binding; lipid binding; |
| ◆ Recombinant Proteins | ||
| TRIP10-2477H | Recombinant human TRIP10, His-tagged | +Inquiry |
| TRIP10-405H | Recombinant Human TRIP10, His-tagged | +Inquiry |
| TRIP10-2636H | Recombinant Human TRIP10 Protein, MYC/DDK-tagged | +Inquiry |
| TRIP10-1738H | Recombinant Human TRIP10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TRIP10-3420H | Recombinant Human TRIP10, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRIP10-311HKCL | Human TRIP10 Knockdown Cell Lysate | +Inquiry |
| TRIP10-1838HCL | Recombinant Human TRIP10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIP10 Products
Required fields are marked with *
My Review for All TRIP10 Products
Required fields are marked with *
