Recombinant Human TRMU protein, His-tagged
Cat.No. : | TRMU-6754H |
Product Overview : | Recombinant Human TRMU protein(1-267 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-267 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MKKSLSRSTLRSPKGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | TRMU tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [ Homo sapiens ] |
Official Symbol | TRMU |
Synonyms | TRMU; tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase; TRMT, tRNA (5 methylaminomethyl 2 thiouridylate) methyltransferase; mitochondrial tRNA-specific 2-thiouridylase 1; FLJ10140; MTO2; MTO2 homolog; mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase; MTU1; TRMT; TRMT1; TRNT1; MGC99627; |
Gene ID | 55687 |
mRNA Refseq | NM_018006 |
Protein Refseq | NP_060476 |
MIM | 610230 |
UniProt ID | O75648 |
◆ Recombinant Proteins | ||
TRMU-5913H | Recombinant Human TRMU Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TRMU-3004C | Recombinant Chicken TRMU | +Inquiry |
TRMU-9642M | Recombinant Mouse TRMU Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMU-2779Z | Recombinant Zebrafish TRMU | +Inquiry |
TRMU-17425M | Recombinant Mouse TRMU Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRMU-751HCL | Recombinant Human TRMU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRMU Products
Required fields are marked with *
My Review for All TRMU Products
Required fields are marked with *
0
Inquiry Basket