Recombinant Human TRMU protein, His-tagged

Cat.No. : TRMU-6754H
Product Overview : Recombinant Human TRMU protein(1-267 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-267 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MKKSLSRSTLRSPKGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name TRMU tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [ Homo sapiens ]
Official Symbol TRMU
Synonyms TRMU; tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase; TRMT, tRNA (5 methylaminomethyl 2 thiouridylate) methyltransferase; mitochondrial tRNA-specific 2-thiouridylase 1; FLJ10140; MTO2; MTO2 homolog; mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase; MTU1; TRMT; TRMT1; TRNT1; MGC99627;
Gene ID 55687
mRNA Refseq NM_018006
Protein Refseq NP_060476
MIM 610230
UniProt ID O75648

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRMU Products

Required fields are marked with *

My Review for All TRMU Products

Required fields are marked with *

0
cart-icon