Recombinant Human TRMU protein, His-tagged
| Cat.No. : | TRMU-6754H |
| Product Overview : | Recombinant Human TRMU protein(1-267 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-267 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MKKSLSRSTLRSPKGFSEIGLKLEMVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | TRMU tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase [ Homo sapiens ] |
| Official Symbol | TRMU |
| Synonyms | TRMU; tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase; TRMT, tRNA (5 methylaminomethyl 2 thiouridylate) methyltransferase; mitochondrial tRNA-specific 2-thiouridylase 1; FLJ10140; MTO2; MTO2 homolog; mitochondrial 5-methylaminomethyl-2-thiouridylate-methyltransferase; MTU1; TRMT; TRMT1; TRNT1; MGC99627; |
| Gene ID | 55687 |
| mRNA Refseq | NM_018006 |
| Protein Refseq | NP_060476 |
| MIM | 610230 |
| UniProt ID | O75648 |
| ◆ Recombinant Proteins | ||
| TRMU-6754H | Recombinant Human TRMU protein, His-tagged | +Inquiry |
| TRMU-5913H | Recombinant Human TRMU Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TRMU-3004C | Recombinant Chicken TRMU | +Inquiry |
| TRMU-2779Z | Recombinant Zebrafish TRMU | +Inquiry |
| TRMU-9642M | Recombinant Mouse TRMU Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRMU-751HCL | Recombinant Human TRMU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRMU Products
Required fields are marked with *
My Review for All TRMU Products
Required fields are marked with *
