Recombinant Human TRPA1 Protein, N-GST-tagged

Cat.No. : TRPA1-18H
Product Overview : Human TRPA1 partial ORF ( NP_015628, 1033 a.a. - 1117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1033-1117 aa
Description : The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.09 kDa
AA Sequence : IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TRPA1 transient receptor potential cation channel subfamily A member 1 [ Homo sapiens (human) ]
Official Symbol TRPA1
Synonyms FEPS; p120; FEPS1; ANKTM1; transient receptor potential cation channel subfamily A member 1; TRPA1
Gene ID 8989
mRNA Refseq NM_007332.3
Protein Refseq NP_015628.2
MIM 604775
UniProt ID O75762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPA1 Products

Required fields are marked with *

My Review for All TRPA1 Products

Required fields are marked with *

0
cart-icon