Recombinant Human TRPA1 Protein, N-GST-tagged
Cat.No. : | TRPA1-18H |
Product Overview : | Human TRPA1 partial ORF ( NP_015628, 1033 a.a. - 1117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1033-1117 aa |
Description : | The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.09 kDa |
AA Sequence : | IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TRPA1 transient receptor potential cation channel subfamily A member 1 [ Homo sapiens (human) ] |
Official Symbol | TRPA1 |
Synonyms | FEPS; p120; FEPS1; ANKTM1; transient receptor potential cation channel subfamily A member 1; TRPA1 |
Gene ID | 8989 |
mRNA Refseq | NM_007332.3 |
Protein Refseq | NP_015628.2 |
MIM | 604775 |
UniProt ID | O75762 |
◆ Recombinant Proteins | ||
TRPA1-9653M | Recombinant Mouse TRPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRPA1-343H | Recombinant Human TRPA1 Protein, His-tagged | +Inquiry |
TRPA1-2844H | Active Recombinant Human TRPA1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
TRPA1-18H | Recombinant Human TRPA1 Protein, N-GST-tagged | +Inquiry |
TRPA1-345H | Recombinant Human TRPA1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPA1-1841HCL | Recombinant Human TRPA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPA1 Products
Required fields are marked with *
My Review for All TRPA1 Products
Required fields are marked with *
0
Inquiry Basket