Recombinant Human TRPC1 protein(31-100 aa), C-His-tagged
| Cat.No. : | TRPC1-2776H |
| Product Overview : | Recombinant Human TRPC1 protein(P48995)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 31-100 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | VMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDIL |
| Gene Name | TRPC1 transient receptor potential cation channel, subfamily C, member 1 [ Homo sapiens ] |
| Official Symbol | TRPC1 |
| Synonyms | TRPC1; transient receptor potential cation channel, subfamily C, member 1; short transient receptor potential channel 1; HTRP 1; TRP-1; transient receptor protein 1; transient receptor potential canonical 1; TRP1; HTRP-1; MGC133334; MGC133335; |
| Gene ID | 7220 |
| mRNA Refseq | NM_001251845 |
| Protein Refseq | NP_001238774 |
| MIM | 602343 |
| UniProt ID | P48995 |
| ◆ Cell & Tissue Lysates | ||
| TRPC1-746HCL | Recombinant Human TRPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPC1 Products
Required fields are marked with *
My Review for All TRPC1 Products
Required fields are marked with *
