Recombinant Human TRPC1 protein(31-100 aa), C-His-tagged

Cat.No. : TRPC1-2776H
Product Overview : Recombinant Human TRPC1 protein(P48995)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-100 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDIL
Gene Name TRPC1 transient receptor potential cation channel, subfamily C, member 1 [ Homo sapiens ]
Official Symbol TRPC1
Synonyms TRPC1; transient receptor potential cation channel, subfamily C, member 1; short transient receptor potential channel 1; HTRP 1; TRP-1; transient receptor protein 1; transient receptor potential canonical 1; TRP1; HTRP-1; MGC133334; MGC133335;
Gene ID 7220
mRNA Refseq NM_001251845
Protein Refseq NP_001238774
MIM 602343
UniProt ID P48995

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPC1 Products

Required fields are marked with *

My Review for All TRPC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon