Recombinant Human TRPC1 protein, His-tagged
Cat.No. : | TRPC1-3387H |
Product Overview : | Recombinant Human TRPC1 protein(1-383 aa), fused to His tag, was expressed in E. coli. |
Availability | August 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-383 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TRPC1 transient receptor potential cation channel, subfamily C, member 1 [ Homo sapiens ] |
Official Symbol | TRPC1 |
Synonyms | TRPC1; transient receptor potential cation channel, subfamily C, member 1; short transient receptor potential channel 1; HTRP 1; TRP-1; transient receptor protein 1; transient receptor potential canonical 1; TRP1; HTRP-1; MGC133334; MGC133335; |
Gene ID | 7220 |
mRNA Refseq | NM_001251845 |
Protein Refseq | NP_001238774 |
MIM | 602343 |
UniProt ID | P48995 |
◆ Recombinant Proteins | ||
TRPC1-6299R | Recombinant Rat TRPC1 Protein | +Inquiry |
Trpc1-1326M | Recombinant Mouse Trpc1 Full Length Transmembrane protein, His-tagged | +Inquiry |
RFL19923OF | Recombinant Full Length Rabbit Short Transient Receptor Potential Channel 1(Trpc1) Protein, His-Tagged | +Inquiry |
TRPC1-7834Z | Recombinant Zebrafish TRPC1 | +Inquiry |
TRPC1-4801R | Recombinant Rhesus Macaque TRPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRPC1-746HCL | Recombinant Human TRPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPC1 Products
Required fields are marked with *
My Review for All TRPC1 Products
Required fields are marked with *