Recombinant Human TRPC6 protein, hFc-tagged
| Cat.No. : | TRPC6-754H |
| Product Overview : | Recombinant Human TRPC6 protein(Q9Y210)(543-592aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 543-592aa |
| Tag : | C-hFc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ |
| Gene Name | TRPC6 transient receptor potential cation channel, subfamily C, member 6 [ Homo sapiens ] |
| Official Symbol | TRPC6 |
| Synonyms | TRPC6; transient receptor potential cation channel, subfamily C, member 6; short transient receptor potential channel 6; TRP6; TRP-6; transient receptor protein 6; FSGS2; FLJ11098; FLJ14863; |
| Gene ID | 7225 |
| mRNA Refseq | NM_004621 |
| Protein Refseq | NP_004612 |
| MIM | 603652 |
| UniProt ID | Q9Y210 |
| ◆ Recombinant Proteins | ||
| TRPC6-754H | Recombinant Human TRPC6 protein, hFc-tagged | +Inquiry |
| TRPC6-347H | Recombinant Human TRPC6 Protein, His-tagged | +Inquiry |
| RFL28781BF | Recombinant Full Length Bovine Short Transient Receptor Potential Channel 6(Trpc6) Protein, His-Tagged | +Inquiry |
| TRPC6-1162HFL | Recombinant Human TRPC6 protein, His&Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TRPC6-741HCL | Recombinant Human TRPC6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRPC6 Products
Required fields are marked with *
My Review for All TRPC6 Products
Required fields are marked with *
