Recombinant Human TRPC6 protein, hFc-tagged

Cat.No. : TRPC6-754H
Product Overview : Recombinant Human TRPC6 protein(Q9Y210)(543-592aa), fused with C-terminal hFc tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 543-592aa
Tag : C-hFc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 34.7 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ
Gene Name TRPC6 transient receptor potential cation channel, subfamily C, member 6 [ Homo sapiens ]
Official Symbol TRPC6
Synonyms TRPC6; transient receptor potential cation channel, subfamily C, member 6; short transient receptor potential channel 6; TRP6; TRP-6; transient receptor protein 6; FSGS2; FLJ11098; FLJ14863;
Gene ID 7225
mRNA Refseq NM_004621
Protein Refseq NP_004612
MIM 603652
UniProt ID Q9Y210

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRPC6 Products

Required fields are marked with *

My Review for All TRPC6 Products

Required fields are marked with *

0
cart-icon