Recombinant Human TSACC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TSACC-1134H |
Product Overview : | C1orf182 MS Standard C13 and N15-labeled recombinant protein (NP_653228) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TSACC (TSSK6 Activating Cochaperone) is a Protein Coding gene. Diseases associated with TSACC include Adrenal Insufficiency, Congenital, With 46,Xy Sex Reversal, Partial Or Complete. Gene Ontology (GO) annotations related to this gene include chaperone binding. |
Molecular Mass : | 13.7 kDa |
AA Sequence : | MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLGLLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHLPQFSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TSACC TSSK6 activating cochaperone [ Homo sapiens (human) ] |
Official Symbol | TSACC |
Synonyms | TSACC; TSSK6 activating cochaperone; SIP; SSTK-IP; C1orf182; TSSK6-activating co-chaperone protein; SSTK-interacting protein (SSTK-IP); TSSK6 activating co-chaperone |
Gene ID | 128229 |
mRNA Refseq | NM_144627 |
Protein Refseq | NP_653228 |
UniProt ID | Q96A04 |
◆ Recombinant Proteins | ||
TSACC-17472M | Recombinant Mouse TSACC Protein | +Inquiry |
TSACC-1349H | Recombinant Human TSACC | +Inquiry |
Tsacc-6679M | Recombinant Mouse Tsacc Protein, Myc/DDK-tagged | +Inquiry |
TSACC-1052C | Recombinant Cynomolgus TSACC Protein, His-tagged | +Inquiry |
TSACC-2802H | Recombinant Human TSACC Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TSACC Products
Required fields are marked with *
My Review for All TSACC Products
Required fields are marked with *
0
Inquiry Basket