Recombinant Human TSACC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TSACC-1134H
Product Overview : C1orf182 MS Standard C13 and N15-labeled recombinant protein (NP_653228) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TSACC (TSSK6 Activating Cochaperone) is a Protein Coding gene. Diseases associated with TSACC include Adrenal Insufficiency, Congenital, With 46,Xy Sex Reversal, Partial Or Complete. Gene Ontology (GO) annotations related to this gene include chaperone binding.
Molecular Mass : 13.7 kDa
AA Sequence : MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLGLLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHLPQFSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TSACC TSSK6 activating cochaperone [ Homo sapiens (human) ]
Official Symbol TSACC
Synonyms TSACC; TSSK6 activating cochaperone; SIP; SSTK-IP; C1orf182; TSSK6-activating co-chaperone protein; SSTK-interacting protein (SSTK-IP); TSSK6 activating co-chaperone
Gene ID 128229
mRNA Refseq NM_144627
Protein Refseq NP_653228
UniProt ID Q96A04

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSACC Products

Required fields are marked with *

My Review for All TSACC Products

Required fields are marked with *

0
cart-icon
0
compare icon