Recombinant Human TSHB [Y124D] and TSHA Heterodimer Protein, His tagged
Cat.No. : | TSHB-TSHA-08HM |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | His |
Protein Length : | TSHB (Phe21-Val138, Y124D mutation) & TSHA (Ala25-Ser116) |
Description : | The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. Thyroid stimulating hormone functions in the control of thyroid structure and metabolism. The protein encoded by this gene is the beta subunit of thyroid stimulating hormone. Mutations in this gene are associated with congenital central and secondary hypothyroidism and Hashimoto's thyroiditis. Alternative splicing of this gene results in multiple transcript variants. |
Molecular Mass : | TSHB: 15 kDa TSHA: 12 kDa |
AA Sequence : | TSHB: FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNDCTKPQKSYLVGFSVHHHHHHHHHH TSHA: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSHHHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH 7.4 |
Concentration : | 0.15 mg/mL by BCA |
GeneID 2 : | 1081 |
Gene Name | TSHB thyroid stimulating hormone subunit beta [ Homo sapiens (human) ] |
Official Symbol | TSHB |
Synonyms | TSHB; thyroid stimulating hormone, beta; thyrotropin subunit beta; thyrotropin beta chain; thyrotropin beta subunit; thyroid-stimulating hormone subunit beta; TSH-B; TSH-BETA |
Gene ID | 7252 |
mRNA Refseq | NM_000549 |
Protein Refseq | NP_000540 |
MIM | 188540 |
UniProt ID | P01222 |
Gene Name 2 | CGA glycoprotein hormones, alpha polypeptide [ Homo sapiens (human) ] |
Official Symbol 2 | TSHA |
Synonyms 2 | CGA; glycoprotein hormones, alpha polypeptide; HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA; glycoprotein hormones alpha chain; FSH-alpha; LSH-alpha; TSH-alpha; anterior pituitary glycoprotein hormones common subunit alpha; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha chain; follicle-stimulating hormone alpha subunit; follitropin alpha chain; luteinizing hormone alpha chain; lutropin alpha chain; thyroid-stimulating hormone alpha chain; thyrotropin alpha chain |
mRNA Refseq 2 | NM_000735 |
Protein Refseq 2 | NP_000726 |
MIM 2 | 118850 |
UniProt ID 2 | P01215 |
Gene ID 2 | 1081 |
◆ Recombinant Proteins | ||
TSHB-TSHA-08HM | Recombinant Human TSHB [Y124D] and TSHA Heterodimer Protein, His tagged | +Inquiry |
TSHB-TSHA-03M | Recombinant Mouse TSHB and TSHA Protein, His tagged | +Inquiry |
TSHB-TSHA-04M | Recombinant Mouse TSHB and TSHA Protein, His tagged | +Inquiry |
TSHB-TSHA-02M | Recombinant Mouse TSHB and TSHA Protein, His tagged | +Inquiry |
TSHB-TSHA-06M | Recombinant Mouse TSHB and TSHA Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSHB, TSHA Products
Required fields are marked with *
My Review for All TSHB, TSHA Products
Required fields are marked with *