Recombinant Human TSHB [Y124D] and TSHA Heterodimer Protein, His tagged

Cat.No. : TSHB-TSHA-08HM
Availability September 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : His
Protein Length : TSHB (Phe21-Val138, Y124D mutation) & TSHA (Ala25-Ser116)
Description : The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. Thyroid stimulating hormone functions in the control of thyroid structure and metabolism. The protein encoded by this gene is the beta subunit of thyroid stimulating hormone. Mutations in this gene are associated with congenital central and secondary hypothyroidism and Hashimoto's thyroiditis. Alternative splicing of this gene results in multiple transcript variants.
Molecular Mass : TSHB: 15 kDa TSHA: 12 kDa
AA Sequence : TSHB: FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNDCTKPQKSYLVGFSVHHHHHHHHHH TSHA: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSHHHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH 7.4
Concentration : 0.15 mg/mL by BCA
GeneID 2 : 1081
Gene Name TSHB thyroid stimulating hormone subunit beta [ Homo sapiens (human) ]
Official Symbol TSHB
Synonyms TSHB; thyroid stimulating hormone, beta; thyrotropin subunit beta; thyrotropin beta chain; thyrotropin beta subunit; thyroid-stimulating hormone subunit beta; TSH-B; TSH-BETA
Gene ID 7252
mRNA Refseq NM_000549
Protein Refseq NP_000540
MIM 188540
UniProt ID P01222
Gene Name 2 CGA glycoprotein hormones, alpha polypeptide [ Homo sapiens (human) ]
Official Symbol 2 TSHA
Synonyms 2 CGA; glycoprotein hormones, alpha polypeptide; HCG; LHA; FSHA; GPA1; GPHa; TSHA; GPHA1; CG-ALPHA; glycoprotein hormones alpha chain; FSH-alpha; LSH-alpha; TSH-alpha; anterior pituitary glycoprotein hormones common subunit alpha; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha chain; follicle-stimulating hormone alpha subunit; follitropin alpha chain; luteinizing hormone alpha chain; lutropin alpha chain; thyroid-stimulating hormone alpha chain; thyrotropin alpha chain
mRNA Refseq 2 NM_000735
Protein Refseq 2 NP_000726
MIM 2 118850
UniProt ID 2 P01215
Gene ID 2 1081

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSHB, TSHA Products

Required fields are marked with *

My Review for All TSHB, TSHA Products

Required fields are marked with *

0
cart-icon