Recombinant Human TSHR protein(311-380 aa), C-His-tagged
Cat.No. : | TSHR-2669H |
Product Overview : | Recombinant Human TSHR protein(P16473)(311-380 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 311-380 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETLQA |
Gene Name | TSHR thyroid stimulating hormone receptor [ Homo sapiens ] |
Official Symbol | TSHR |
Synonyms | TSHR; thyroid stimulating hormone receptor; thyrotropin receptor; LGR3; TSH-R; thyrotropin receptor-I, hTSHR-I; seven transmembrane helix receptor; thyroid-stimulating hormone receptor; thyroid stimulating hormone receptor, isoform 2; CHNG1; hTSHR-I; MGC75129; |
Gene ID | 7253 |
mRNA Refseq | NM_000369 |
Protein Refseq | NP_000360 |
UniProt ID | P16473 |
◆ Recombinant Proteins | ||
TSHR-7384Z | Recombinant Zebrafish TSHR | +Inquiry |
TSHR-6317R | Recombinant Rat Tshr protein, His-tagged | +Inquiry |
TSHR-14H | Recombinant Human thyroid stimulating hormone receptor Protein, His tagged | +Inquiry |
TSHR-2048H | Active Recombinant Human TSHR Full Length Transmembrane protein(Nanodisc) | +Inquiry |
TSHR-717HCL | Recombinant Human TSHR cell lysate, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSHR Products
Required fields are marked with *
My Review for All TSHR Products
Required fields are marked with *