Recombinant Human TSHR protein(311-380 aa), C-His-tagged
| Cat.No. : | TSHR-2669H |
| Product Overview : | Recombinant Human TSHR protein(P16473)(311-380 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 311-380 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETLQA |
| Gene Name | TSHR thyroid stimulating hormone receptor [ Homo sapiens ] |
| Official Symbol | TSHR |
| Synonyms | TSHR; thyroid stimulating hormone receptor; thyrotropin receptor; LGR3; TSH-R; thyrotropin receptor-I, hTSHR-I; seven transmembrane helix receptor; thyroid-stimulating hormone receptor; thyroid stimulating hormone receptor, isoform 2; CHNG1; hTSHR-I; MGC75129; |
| Gene ID | 7253 |
| mRNA Refseq | NM_000369 |
| Protein Refseq | NP_000360 |
| UniProt ID | P16473 |
| ◆ Recombinant Proteins | ||
| TSHR-717HCL | Recombinant Human TSHR cell lysate, Myc/DDK-tagged | +Inquiry |
| TSHR-14H | Recombinant Human thyroid stimulating hormone receptor Protein, His tagged | +Inquiry |
| TSHR-3451H | Recombinant Human TSHR | +Inquiry |
| TSHR-7384Z | Recombinant Zebrafish TSHR | +Inquiry |
| TSHR-3450H | Recombinant Human TSHR, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSHR Products
Required fields are marked with *
My Review for All TSHR Products
Required fields are marked with *



