Recombinant Human TSHR protein(311-380 aa), C-His-tagged

Cat.No. : TSHR-2669H
Product Overview : Recombinant Human TSHR protein(P16473)(311-380 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 311-380 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 11 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : QRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQEDEIIGFGQELKNPQEETLQA
Gene Name TSHR thyroid stimulating hormone receptor [ Homo sapiens ]
Official Symbol TSHR
Synonyms TSHR; thyroid stimulating hormone receptor; thyrotropin receptor; LGR3; TSH-R; thyrotropin receptor-I, hTSHR-I; seven transmembrane helix receptor; thyroid-stimulating hormone receptor; thyroid stimulating hormone receptor, isoform 2; CHNG1; hTSHR-I; MGC75129;
Gene ID 7253
mRNA Refseq NM_000369
Protein Refseq NP_000360
UniProt ID P16473

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSHR Products

Required fields are marked with *

My Review for All TSHR Products

Required fields are marked with *

0
cart-icon