Recombinant Human TSPAN7 protein

Cat.No. : TSPAN7-237H
Product Overview : Recombinant Human TSPAN7 was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy.
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 27.6 kDa
AA Sequence : MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLF GCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSC CGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAF SQLIGMLLACCLSRFITANQYEMV
Purity : > 95 % by SDS-PAGE.
Applications : Antibody Production; Functional Study(Recommended usage only, not validated yet); Compound Screening(Recommended usage only, not validated yet).
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TSPAN7 tetraspanin 7 [ Homo sapiens ]
Official Symbol TSPAN7
Synonyms TSPAN7; tetraspanin 7; mental retardation, X linked 58 , MRX58, MXS1, TM4SF2, transmembrane 4 superfamily member 2; tetraspanin-7; A15; CD231; DXS1692E; TALLA 1; tspan-7; CD231 antigen; tetraspanin protein; transmembrane protein A15; cell surface glycoprotein A15; transmembrane 4 superfamily 2b; transmembrane 4 superfamily member 2; membrane component chromosome X surface marker 1; membrane component, X chromosome, surface marker 1; T-cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; MXS1; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b;
Gene ID 7102
mRNA Refseq NM_004615
Protein Refseq NP_004606
MIM 300096
UniProt ID P41732
Chromosome Location Xp11.4
Pathway Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSPAN7 Products

Required fields are marked with *

My Review for All TSPAN7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon