Recombinant Human TSPO Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TSPO-6213H |
Product Overview : | TSPO MS Standard C13 and N15-labeled recombinant protein (NP_000705) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. |
Molecular Mass : | 18.8 kDa |
AA Sequence : | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TSPO translocator protein [ Homo sapiens (human) ] |
Official Symbol | TSPO |
Synonyms | TSPO; translocator protein (18kDa); benzodiazapine receptor (peripheral), BZRP; translocator protein; DBI; IBP; MBR; mDRC; PBR; peripheral type benzodiazepine receptor/recognition site; pk18; PKBS; mitochondrial benzodiazepine receptor; benzodiazepine peripheral binding site; peripheral-type benzodiazepine receptor; PBS; BPBS; BZRP; PTBR; |
Gene ID | 706 |
mRNA Refseq | NM_000714 |
Protein Refseq | NP_000705 |
MIM | 109610 |
UniProt ID | B1AH88 |
◆ Recombinant Proteins | ||
TSPO-9691M | Recombinant Mouse TSPO Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPO-142HFL | Active Recombinant Full Length Human TSPO Protein, C-Flag-tagged | +Inquiry |
TSPO-5985R | Recombinant Rat TSPO Protein, His (Fc)-Avi-tagged | +Inquiry |
TSPO-5005R | Recombinant Rhesus monkey TSPO Protein, His-tagged | +Inquiry |
TSPO-5333C | Recombinant Chicken TSPO | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPO-703HCL | Recombinant Human TSPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPO Products
Required fields are marked with *
My Review for All TSPO Products
Required fields are marked with *