Recombinant Human TSPO Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TSPO-6213H
Product Overview : TSPO MS Standard C13 and N15-labeled recombinant protein (NP_000705) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein.
Molecular Mass : 18.8 kDa
AA Sequence : MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TSPO translocator protein [ Homo sapiens (human) ]
Official Symbol TSPO
Synonyms TSPO; translocator protein (18kDa); benzodiazapine receptor (peripheral), BZRP; translocator protein; DBI; IBP; MBR; mDRC; PBR; peripheral type benzodiazepine receptor/recognition site; pk18; PKBS; mitochondrial benzodiazepine receptor; benzodiazepine peripheral binding site; peripheral-type benzodiazepine receptor; PBS; BPBS; BZRP; PTBR;
Gene ID 706
mRNA Refseq NM_000714
Protein Refseq NP_000705
MIM 109610
UniProt ID B1AH88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSPO Products

Required fields are marked with *

My Review for All TSPO Products

Required fields are marked with *

0
cart-icon