Recombinant Human TSPO Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TSPO-6213H
• Product Overview: TSPO MS Standard C13 and N15-labeled recombinant protein (NP_000705) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein.
• Molecular Mass: 18.8 kDa
• AA Sequence: MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TSPO translocator protein [ Homo sapiens (human) ]
• Official Symbol: TSPO
• Synonyms: TSPO; translocator protein (18kDa); benzodiazapine receptor (peripheral), BZRP; translocator protein; DBI; IBP; MBR; mDRC; PBR; peripheral type benzodiazepine receptor/recognition site; pk18; PKBS; mitochondrial benzodiazepine receptor; benzodiazepine peripheral binding site; peripheral-type benzodiazepine receptor; PBS; BPBS; BZRP; PTBR
• Gene ID: 706
• mRNA Refseq: NM_000714
• Protein Refseq: NP_000705
• MIM: 109610
• UniProt ID: B1AH88