Recombinant Human TSTA3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TSTA3-5498H |
Product Overview : | TSTA3 MS Standard C13 and N15-labeled recombinant protein (NP_003304) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II. |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKSSGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTPFKQAVKETCAWFTDNYEQARKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TSTA3 tissue specific transplantation antigen P35B [ Homo sapiens (human) ] |
Official Symbol | TSTA3 |
Synonyms | TSTA3; tissue specific transplantation antigen P35B; GDP-L-fucose synthase; FX; GDP L fucose synthase; P35B; SDR4E1; short chain dehydrogenase/reductase family 4E; member 1; 3-5 epimerase/4-reductase; red cell NADP(H)-binding protein; tissue specific transplantation antigen 3; GDP-4-keto-6-deoxy-D-mannose epimerase-reductase; GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase; short chain dehydrogenase/reductase family 4E, member 1; |
Gene ID | 7264 |
mRNA Refseq | NM_003313 |
Protein Refseq | NP_003304 |
MIM | 137020 |
UniProt ID | Q13630 |
◆ Recombinant Proteins | ||
Tsta3-8090M | Recombinant Mouse Tsta3 protein, His & T7-tagged | +Inquiry |
TSTA3-159H | Recombinant Human TSTA3 Protein, His-tagged | +Inquiry |
TSTA3-9705M | Recombinant Mouse TSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSTA3-4826R | Recombinant Rhesus Macaque TSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TSTA3-2896H | Recombinant Human TSTA3, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSTA3-691HCL | Recombinant Human TSTA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSTA3 Products
Required fields are marked with *
My Review for All TSTA3 Products
Required fields are marked with *
0
Inquiry Basket