Recombinant Human TTC32 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TTC32-4253H |
Product Overview : | TTC32 MS Standard C13 and N15-labeled recombinant protein (NP_001008238) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | TTC32 (Tetratricopeptide Repeat Domain 32) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include identical protein binding. An important paralog of this gene is SPAG1. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKNYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TTC32 tetratricopeptide repeat domain 32 [ Homo sapiens (human) ] |
Official Symbol | TTC32 |
Synonyms | TTC32; tetratricopeptide repeat domain 32; tetratricopeptide repeat protein 32; TPR repeat protein 32; |
Gene ID | 130502 |
mRNA Refseq | NM_001008237 |
Protein Refseq | NP_001008238 |
UniProt ID | Q5I0X7 |
◆ Recombinant Proteins | ||
TTC32-9720M | Recombinant Mouse TTC32 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTC32-5015R | Recombinant Rhesus monkey TTC32 Protein, His-tagged | +Inquiry |
Ttc32-6709M | Recombinant Mouse Ttc32 Protein, Myc/DDK-tagged | +Inquiry |
TTC32-7182H | Recombinant Human Tetratricopeptide Repeat Domain 32, His-tagged | +Inquiry |
TTC32-17564M | Recombinant Mouse TTC32 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC32-679HCL | Recombinant Human TTC32 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTC32 Products
Required fields are marked with *
My Review for All TTC32 Products
Required fields are marked with *