Recombinant Human TTC32 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TTC32-4253H
• Product Overview: TTC32 MS Standard C13 and N15-labeled recombinant protein (NP_001008238) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: TTC32 (Tetratricopeptide Repeat Domain 32) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include identical protein binding. An important paralog of this gene is SPAG1.
• Molecular Mass: 17.3 kDa
• AA Sequence: MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATAYNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQTILDKEEKQRRNVAKNYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TTC32 tetratricopeptide repeat domain 32 [ Homo sapiens (human) ]
• Official Symbol: TTC32
• Synonyms: TTC32; tetratricopeptide repeat domain 32; tetratricopeptide repeat protein 32; TPR repeat protein 32
• Gene ID: 130502
• mRNA Refseq: NM_001008237
• Protein Refseq: NP_001008238
• UniProt ID: Q5I0X7