"TTC4" Related Products

Recombinant Human TTC4 protein, T7-tagged

Cat.No.: TTC4-164H
Product Overview: Recombinant human TTC4 fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDPRENPDL ACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLYTNRAAAQYYLGNFRSA LNDVTAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIEQRDVRKANLK EKKERNQNEALLQAIKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYPEYA QSDFISAFHEDSRFIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKALT PAFLVCVGSSPFCKNFLRGRKVYQIR
Purity: >90% by SDS-PAGE
Applications: 1. May be used for human TTC4 protein functional study in vitro.2. May be used for in vitro protein-protein interaction measurement for mapping TTC4 binder.3. May be used as antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: TTC4 tetratricopeptide repeat domain 4 [ Homo sapiens ]
Official Symbol: TTC4
Synonyms: TTC4; tetratricopeptide repeat domain 4; tetratricopeptide repeat protein 4; FLJ41930; MGC5097; TPR repeat protein 4; DKFZp781B0622;
Gene ID: 7268
mRNA Refseq: NM_004623
Protein Refseq: NP_004614
MIM: 606753
UniProt ID: O95801
Chromosome Location: 1p32
Function: binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.