Recombinant Human TTLL4 Protein, his-tagged
Cat.No. : | TTLL4-3480H |
Product Overview : | Recombinant Human TTLL4 Protein (601-955 aa) is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 601-955 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
Molecular Mass : | 41 kDa |
AA Sequence : | WEQRKLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPSFRSIREHQKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESSSRQKWIVKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALWNYLSQKGVNSDSIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDIISSPSSCSSS |
Purity : | > 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Notes : | Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Stability : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | TTLL4 tubulin tyrosine ligase-like family, member 4 [ Homo sapiens ] |
Official Symbol | TTLL4 |
Synonyms | TTLL4; tubulin polyglutamylase TTLL4; tubulin tyrosine ligase-like family, member 4; tubulin--tyrosine ligase-like protein 4 |
Gene ID | 9654 |
mRNA Refseq | NM_014640.4 |
Protein Refseq | NP_055455.3 |
UniProt ID | Q14679 |
◆ Recombinant Proteins | ||
TTLL4-3481H | Recombinant Human TTLL4, GST-tagged | +Inquiry |
TTLL4-9742M | Recombinant Mouse TTLL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
TTLL4-17595M | Recombinant Mouse TTLL4 Protein | +Inquiry |
TTLL4-3480H | Recombinant Human TTLL4 Protein, his-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTLL4 Products
Required fields are marked with *
My Review for All TTLL4 Products
Required fields are marked with *
0
Inquiry Basket