Recombinant Human TUBA4A protein
Cat.No. : | TUBA4A-5047H |
Product Overview : | Recombinant Human TUBA4A protein(P68366)(1-448 aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Non |
Protein Length : | 1-448 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGIDSYEDEDEGEE |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | TUBA4A tubulin, alpha 4a [ Homo sapiens ] |
Official Symbol | TUBA4A |
Synonyms | TUBA4A; tubulin, alpha 4a; TUBA1, tubulin, alpha 1 , tubulin, alpha 1 (testis specific); tubulin alpha-4A chain; FLJ30169; H2 ALPHA; tubulin H2-alpha; tubulin alpha-1 chain; tubulin, alpha 1 (testis specific); TUBA1; H2-ALPHA; |
Gene ID | 7277 |
mRNA Refseq | NM_006000 |
Protein Refseq | NP_005991 |
MIM | 191110 |
UniProt ID | P68366 |
◆ Recombinant Proteins | ||
TUBA4A-17613M | Recombinant Mouse TUBA4A Protein | +Inquiry |
TUBA4A-5050H | Recombinant Human TUBA4A protein | +Inquiry |
TUBA4A-5049H | Recombinant Human TUBA4A protein, Avi-tagged, Biotinylated | +Inquiry |
TUBA4A-5048H | Recombinant Human TUBA4A protein | +Inquiry |
Tuba4a-342M | Recombinant Mouse Tuba4a protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA4A-656HCL | Recombinant Human TUBA4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBA4A Products
Required fields are marked with *
My Review for All TUBA4A Products
Required fields are marked with *