Recombinant Human TUBA4A protein
| Cat.No. : | TUBA4A-5047H |
| Product Overview : | Recombinant Human TUBA4A protein(P68366)(1-448 aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | Non |
| Protein Length : | 1-448 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGK HVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLD RIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITA SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPP TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE AREDMAALEKDYEEVGIDSYEDEDEGEE |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | TUBA4A tubulin, alpha 4a [ Homo sapiens ] |
| Official Symbol | TUBA4A |
| Synonyms | TUBA4A; tubulin, alpha 4a; TUBA1, tubulin, alpha 1 , tubulin, alpha 1 (testis specific); tubulin alpha-4A chain; FLJ30169; H2 ALPHA; tubulin H2-alpha; tubulin alpha-1 chain; tubulin, alpha 1 (testis specific); TUBA1; H2-ALPHA; |
| Gene ID | 7277 |
| mRNA Refseq | NM_006000 |
| Protein Refseq | NP_005991 |
| MIM | 191110 |
| UniProt ID | P68366 |
| ◆ Recombinant Proteins | ||
| TUBA4A-17613M | Recombinant Mouse TUBA4A Protein | +Inquiry |
| TUBA4A-5050H | Recombinant Human TUBA4A protein | +Inquiry |
| TUBA4A-5049H | Recombinant Human TUBA4A protein, Avi-tagged, Biotinylated | +Inquiry |
| TUBA4A-5048H | Recombinant Human TUBA4A protein | +Inquiry |
| Tuba4a-342M | Recombinant Mouse Tuba4a protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TUBA4A-656HCL | Recombinant Human TUBA4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TUBA4A Products
Required fields are marked with *
My Review for All TUBA4A Products
Required fields are marked with *
