"TUBB1" Related Products

Expand
Expand

Recombinant Human TUBB1 Protein, GST-tagged

Cat.No.: TUBB1-03H
Product Overview: Human TUBB1 full-length ORF ( NP_110400.1, 1 a.a. - 451 a.a.) recombinant protein with GST-tag at N-terminal.
Source: Wheat germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 76.7 kDa
AA Sequence: MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TUBB1 tubulin, beta 1 class VI [ Homo sapiens ]
Official Symbol: TUBB1
Synonyms: TUBB1; tubulin, beta 1 class VI; tubulin, beta 1; tubulin beta-1 chain; class VI beta tubulin; dJ543J19.4; class VI beta-tubulin; beta tubulin 1, class VI;
Gene ID: 81027
mRNA Refseq: NM_030773
Protein Refseq: NP_110400
MIM: 612901
UniProt ID: Q9H4B7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.