"TUBB1" Related Products

Expand
Expand

Recombinant Human TUBB1 Protein, GST-tagged

Cat.No. : TUBB1-03H
Product Overview : Human TUBB1 full-length ORF ( NP_110400.1, 1 a.a. - 451 a.a.) recombinant protein with GST-tag at N-terminal.
Source : Wheat germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 76.7 kDa
AA Sequence : MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : TUBB1 tubulin, beta 1 class VI [ Homo sapiens ]
Official Symbol : TUBB1
Synonyms : TUBB1; tubulin, beta 1 class VI; tubulin, beta 1; tubulin beta-1 chain; class VI beta tubulin; dJ543J19.4; class VI beta-tubulin; beta tubulin 1, class VI;
Gene ID : 81027
mRNA Refseq : NM_030773
Protein Refseq : NP_110400
MIM : 612901
UniProt ID : Q9H4B7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.