Recombinant Full Length Human TUBB1 Protein, GST-tagged
Cat.No. : | TUBB1-6776HF |
Product Overview : | Human TUBB1 full-length ORF ( NP_110400.1, 1 a.a. - 451 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 451 amino acids |
Description : | Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is a plasma integral membrane protein which functions both as an organic cation transporter and as a sodium-dependent high affinity carnitine transporter. The encoded protein is involved in the active cellular uptake of carnitine. Mutations in this gene are the cause of systemic primary carnitine deficiency (CDSP), an autosomal recessive disorder manifested early in life by hypoketotic hypoglycemia and acute metabolic decompensation, and later in life by skeletal myopathy or cardiomyopathy. Alternative splicing of this gene results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 76.7 kDa |
AA Sequence : | MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TUBB1 tubulin, beta 1 class VI [ Homo sapiens ] |
Official Symbol | TUBB1 |
Synonyms | TUBB1; tubulin, beta 1 class VI; tubulin, beta 1; tubulin beta-1 chain; class VI beta tubulin; dJ543J19.4; class VI beta-tubulin; beta tubulin 1, class VI; |
Gene ID | 81027 |
mRNA Refseq | NM_030773 |
Protein Refseq | NP_110400 |
MIM | 612901 |
UniProt ID | Q9H4B7 |
◆ Recombinant Proteins | ||
TUBB1-6776HF | Recombinant Full Length Human TUBB1 Protein, GST-tagged | +Inquiry |
TUBB1-6610H | Recombinant Human TUBB1 Protein (Ser166-His451), N-His tagged | +Inquiry |
TUBB1-6609H | Recombinant Human TUBB1 Protein (Ser166-His452), His tagged | +Inquiry |
Tubb1-1304M | Recombinant Mouse Tubb1 protein, His & T7-tagged | +Inquiry |
TUBB1-6995C | Recombinant Chicken TUBB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBB1-652HCL | Recombinant Human TUBB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TUBB1 Products
Required fields are marked with *
My Review for All TUBB1 Products
Required fields are marked with *
0
Inquiry Basket